SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004592 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004592
Domain Number 1 Region: 461-600
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000103
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004592
Domain Number - Region: 47-162
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000706
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number - Region: 374-497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0016
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004592   Gene: ENSMLUG00000005032   Transcript: ENSMLUT00000005036
Sequence length 694
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:4595604:4656733:1 gene:ENSMLUG00000005032 transcript:ENSMLUT00000005036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASVILPILKKKLAFLSVGGKDRRSGLILTIPLCLEQTNMDELSVTLDYLLSIPSEKCK
ARGFTVIVDGRKSQWNVVKTVVLMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDR
LGFEVILVSANKLTRYIEPCQLTEDFGGSLSYDHMDWLNKRLVFEKFTKESTSLLDELAL
INNGSDKGNQEKERSVDLNFLPSVDPETVLQTGHELLSELQQRRFNGSDGGVSWSPMDDE
LLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQW
GIGDSIRASQPYTEHEIESQHSEWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLSDV
CYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLLEE
KLKSVDVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQRC
EDMVDVRRLKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEKHR
KFVDVAQSTYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHRLE
MAIAFHSNTEKILQDCPEEPEAINDEEQFDEIEAVGKSLLDRLTVPVVYPDGTEQYFGSP
SDMASTAEHIRDRMKLVSLKRQQLRHPEMMTTES
Download sequence
Identical sequences G1P3T3
ENSMLUP00000004592 ENSMLUP00000004592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]