SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004596 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004596
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-28
Family Pleckstrin-homology domain (PH domain) 0.00000783
Further Details:      
 
Domain Number 2 Region: 180-234
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000473
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004596   Gene: ENSMLUG00000005037   Transcript: ENSMLUT00000005040
Sequence length 242
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430021:598850:639233:-1 gene:ENSMLUG00000005037 transcript:ENSMLUT00000005040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPSFFGSEWQKRWCVVSRGLFCYYANEKSKQPKGTFLIKGYSVRMAPHLRKDSKKESCFE
LTSQDRRSYEFTATNPAEARDWVDQISFLLKDLSSLTIPCEEEEEAEGEDEMYDDIDGLD
SQNSGPQRRPIILPGSLGLKQPSEEKEEEEEDIYEVLPDEDLDLEEDESGAGQKRVDYAS
YYQGLWDCHGDQPDELSFQRGDLIRILSKEHNMYGWWVGELNSLIGIVPKEYLTTAFEVE
ER
Download sequence
Identical sequences G1P3T7
ENSMLUP00000004596 ENSMLUP00000004596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]