SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004718 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004718
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily EF-hand 3.13e-50
Family p25-alpha 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004718   Gene: ENSMLUG00000005171   Transcript: ENSMLUT00000005171
Sequence length 182
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430041:813363:815012:-1 gene:ENSMLUG00000005171 transcript:ENSMLUT00000005171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGMAASTDVAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVTDGKAVTGTDVDIV
FSKVKGKSARVINYEEFKKALEELAIKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKT
GGAVDRLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDTKVKKWG
GR
Download sequence
Identical sequences G1P450
ENSMLUP00000004718 ENSMLUP00000004718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]