SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005492 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005492
Domain Number 1 Region: 15-252
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-60
Family DBL homology domain (DH-domain) 0.0000352
Further Details:      
 
Domain Number 2 Region: 250-376
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-36
Family Pleckstrin-homology domain (PH domain) 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005492   Gene: ENSMLUG00000014992   Transcript: ENSMLUT00000006012
Sequence length 825
Comment pep:novel scaffold:Myoluc2.0:GL430382:78714:97558:-1 gene:ENSMLUG00000014992 transcript:ENSMLUT00000006012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSEIESDAHEFEAESWSLSVDPAYAKEQKKEVAKRQDVIYELIQTEVHHVRTLKIMLKV
YSRALQEELQFSSKAISRLFPCADDLLQVHGHFLSRLKERRRESLEEGSDRNYIIQKIGD
LLVQQFSGENGESMKKKYGVFCSGHNEAVSHYKLLLQQNKKFQNLIKKIGSSSIVRRLGV
QECILLVTQRITKYPVLVERIIQNTEAGSKDYEDLTQALNLIKDVISQVDTQVSECEKGQ
RLREIAGRMDLKSSSKLKNGLPFRKEDMLQRQLHLEGTLAWKTTAGRLKDVLVVLLTDVL
LLLQEKDQKYVFASVDSKRPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKE
ERNAWMAHIRRAVESCPDEEEGPFSEAEEERKVVEARALRLRDFQERLSLKDQQIAQSLR
EKQQIFLEMAEMSGLDDSAQPRLLFRGGDLSENLQGEWILKSAMTEIADIQSLICRRLGG
TSGQADRGASAGLHQRAEAFGGSDSTSDPGKTGPHVGGREGQAQGGSQGLPTESQHSFSP
QLVQRIQTLSQLLLSLQAVITQQDSYVEMQRASIQEREKQFRLQSTRGNLLLEQERQRNF
EKQREELAGVQKLQSQLRLEQQRWERQREQQQQELDLAVAHLQQRQSEAARLQEQQAQER
AELEQQRQAYQHDLERLREAQRLVQREREQLELLQRLKKQNTAPRALPPELPTEAQPPSH
APSFNGEGLEGPERPEVARRDSTPAESRPARSDVPIQLLSTTNQIQRQAAVQQQIPTKLA
AFTKGGKDKGGKSRGSQRSESSGEPSHPGTGPPQCLVAAHTAILC
Download sequence
Identical sequences G1P625
ENSMLUP00000005492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]