SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005562 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005562
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-24
Family DBL homology domain (DH-domain) 0.0000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005562   Gene: ENSMLUG00000006072   Transcript: ENSMLUT00000006090
Sequence length 84
Comment pep:novel scaffold:Myoluc2.0:AAPE02072325:1128:4815:1 gene:ENSMLUG00000006072 transcript:ENSMLUT00000006090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTEKANLKLALDAMKDLAQY
VNEVKRDNETLREIRQFQLSIENL
Download sequence
Identical sequences G1P678
ENSMLUP00000005562 ENSMLUP00000005562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]