SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005697 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005697
Domain Number 1 Region: 6-315
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-85
Family Protein kinases, catalytic subunit 0.0000000015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005697
Domain Number - Region: 323-433
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00154
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005697   Gene: ENSMLUG00000006239   Transcript: ENSMLUT00000006239
Sequence length 454
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430501:43448:61338:-1 gene:ENSMLUG00000006239 transcript:ENSMLUT00000006239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTISQSLEHSWIKAIRRRNVRREDSGRKPERRRLKTA
RLKEYTIKSHSSMPPNNTYINFERFSKVLEEVAAAEEGLRGLEHSRRLFHEDIEALTAIY
EEKEAWYREENESIGQDLRRLRQELHKTEALQRQAQEEAKGALLGASGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRAMEQEKQQEVECGLR
Download sequence
Identical sequences G1P6K0
XP_005858855.1.60319 XP_006105972.1.53796 XP_008148843.1.99482 ENSMLUP00000005697 ENSMLUP00000005697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]