SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005919 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005919
Domain Number 1 Region: 232-498
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-81
Family Protein kinases, catalytic subunit 0.000000000179
Further Details:      
 
Domain Number 2 Region: 123-266
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-39
Family SH2 domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 55-173
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-23
Family SH3-domain 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005919   Gene: ENSMLUG00000006477   Transcript: ENSMLUT00000006481
Sequence length 510
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429898:3146725:3155033:-1 gene:ENSMLUG00000006477 transcript:ENSMLUT00000006481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCGCSSNPEDDWMENIDVCENCHYPIVPLDGKATTRPAKLGSEVRDPLVTYQDTNPPAS
PLQDNLVIALHSYEPSHDGDLGFEKGEQLRVLEQNGEWWKAQSLTTGQEGFIPFNFVAKA
NSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVK
HYKIRNLDKGGFYISPRITFPGLQELVRHYTNTPDGLCTRLSRPCQTQKPQKPWWEDEWE
VPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQR
LVRLYAVVTQEPIYIITEYMENGSLVDFLKTPAGIKLTINKLLDMAAQIAEGMAFIEERN
YIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTI
KSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKE
RPEDRPTFDYLRSVLDDFFTATEGQYQPQP
Download sequence
Identical sequences G1P745
ENSMLUP00000005919 ENSMLUP00000005919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]