SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006049 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006049
Domain Number 1 Region: 4-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-72
Family Calponin-homology domain, CH-domain 0.000000787
Further Details:      
 
Domain Number 2 Region: 516-653
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-19
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 334-440
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-19
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 448-549
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-16
Family Spectrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006049   Gene: ENSMLUG00000006561   Transcript: ENSMLUT00000006625
Sequence length 776
Comment pep:novel scaffold:Myoluc2.0:GL429787:9926768:10242349:-1 gene:ENSMLUG00000006561 transcript:ENSMLUT00000006625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKELEKIDKKSFTGLFQLNLKKFGKQHIENLFSDLQDGSRLLDLLEGLTNQKLPKEKGS
TRVHALNNVNKALRVLQKNNVDLVNIGSSDIVDGNHKLTLGLIWNIILHWQVKNVMKNIM
AGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVC
QQSAAQRLEHAFNIAKHQLGIEKLLDPEDVATTYPDKKSILMYVTSLFQVLPQQVSIEAI
QEVEMLPRPSKVTREEHFQLHHQMHYSQQITVSLAQGYERTPSSPKPRFKSYAYTQAAYM
ATSDPTRSPFPSQHLEAPEDKSFGGSLMGTEVNLDSYQTALEEVLSWLLSAEDTLKAQGE
ISKDVEEVKEQFHTHEGYMMDLTSHQGRVGNVLQLGSQLLRTGTLSEDEETEVQEQMNLL
NSRWECLRVASMEKQSNLHKVLMDLQNQQLKELNDWLTKTEERTRKMETEPLGPDLEDLK
RQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDRATTALEEQLKVLGDRWANICRWT
EDRWALLQDILLKWQRFTEEQCLFSTWLSEKEDAVSKLHTSGFKDQSEKLSSLQKLAVLK
TDVENKKENMNKLRSLNRDLLATLKNTSVTQKMEARLDSFAQRWDNLVQQLEKSSAQISQ
TVTTTQPSLTQTTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQILVDSEIRKRLDVD
ITELHSWITRSEAVLQSPEFAIYRKDGNFSDLKEKVNVGYALILLYFPEVLLLCIL
Download sequence
Identical sequences G1P7F2
ENSMLUP00000006049 ENSMLUP00000006049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]