SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006334 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006334
Domain Number 1 Region: 821-990
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.51e-34
Family Ankyrin repeat 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006334
Domain Number - Region: 355-415
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00528
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006334   Gene: ENSMLUG00000006932   Transcript: ENSMLUT00000006930
Sequence length 999
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429830:1437319:1457413:-1 gene:ENSMLUG00000006932 transcript:ENSMLUT00000006930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAKDQSSQGDEEKGPPKSLPYSVETPYGFHLDLDFLKYVDDIEKGNTIKRIPIHRRAKQ
AKFSTLPRNFSLPDSGARLQTALSHQTWSPAVSRKVSLGTEERAQSLPPGEHPQASAGGS
EGSYRRKALLAEAARQLEAAAPRDPELTSGSGRPQLLRASSMPATLLQNRASEDPRLTSG
PPAPPALPPLAAEGAFGPAEGFAGVHNSTPGAATQPQGREFGDLVPGVPELVRERAEPPR
AAEEAPQHLSLPRPRFSPPNALVVSEDAKDELHPRGAEVVFSPGCPTPSPPPLPSPIPET
ELPLEEIELNISEIPPPPPVEVDVRSIGIRVTEESLGLAPADPGSISSLRQQLLALEGEL
SGKTEELAQVRAALQQQEEEIKAKRQRIQELECTVAQLAEKLSHENTEDTQGRADATVNT
EPLQGLLTRESCDKSIGVNLLSSTESESGGAPGEENDLCGQDSHTQRDQSPAEFVPPSQL
SLPQDPEMVLTSSLHSCLSTELRIEEASSEQEGDPQVGDRDLVGGAGDSSCSSDIKAPSA
GREASSELPGKEGPGRPPSSPTDATIGQYVKKIQELLQEQWSCLEHGYPELASAIKQPAS
KLSSIQRQLLSSLNLLLSAYSAQAPAQKESPAPSSSPPPMELSPSTSLKSIMKKKDYGFR
AGGNGTKKNLQFVGVNGGYETTSSEETSGEDSSPEDLSDSEAEKKCDGPEHRWGKDDHPG
CKAGQGISEGTCNTGQGKGLGEELPLPKAERYKPSEEFLNACRALSQYLPDTGTTTDQLL
RQNLNTISQEWFRISSRKSSSPAVVAAYLQPHSPHFLKLLVNLADGNGNTALHYSVSHSN
FSIVKLLLETGVCNVDHQNKAGYTAVMITPLASAETDEDMAVVWKLLREGNVNIQATQGG
QTALMLGVSHDREDMVQALLSCQADVNLQDHDGSSALMLACHCGNADMVRLLLAHPACDS
SLTDKAGRTALSIALKPPAHVEIAELLQAHAEQGRSLRP
Download sequence
Identical sequences G1P854
ENSMLUP00000006334 ENSMLUP00000006334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]