SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006371 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006371
Domain Number 1 Region: 1265-1379
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-34
Family Pleckstrin-homology domain (PH domain) 0.00095
Further Details:      
 
Domain Number 2 Region: 1067-1247
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-17
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006371   Gene: ENSMLUG00000006956   Transcript: ENSMLUT00000006970
Sequence length 1520
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431140:22918:39592:-1 gene:ENSMLUG00000006956 transcript:ENSMLUT00000006970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLA
KIQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLCPGDFYLQVVPSGAQAPRLV
LKCLAPGGGRVQELPVPNEASAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAE
LICPRFVHKGNLMVGHRPSTLPPELPSGPPGLPSPPLPEDALGTRSPGDGHNAPAEGPEG
EYVELLEVTLPMRGTPTDAEGSSGLSRTRTVPTRKGAGGKGRHRRHRAWMHQKGLGPPDQ
DGARPPGEGSSSGASPGSPPEAESLPEAAAQEVSEPPAEALGEASEFCPLRPAEAGGGLS
QGSEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSVPVPLNPGAKEETSQQEALVNLPSP
SEHELPGGSLVKEELEGSEKPESELKEELIPADEKEPQPPEACGPKEEKAQEREQKGPSL
VCTAGPTDPEGLPSDPPPPPQEPVQEVKGDRIPEEAPPVSISDDPDIAWDLMASGFLVLT
GGVDHSGRALLTITPPCPPEEPPPSRGMLSTALHYLHSLLRPDLQTLGLSVLLDLRKAPP
LPPALIPVLSQLQDSGDPRLIQRLLLLSHDDPPAELHGFQGAELLSENDLKRVAKPEELQ
WDLGGHREPSPSHWVETHQEVARLCRLCQGVLGSVRQAIAELEGAAEPEGEEAAGMPEPL
QKVLADPRLMELQRDGGAILMRLRSTHSSKLEGPGPATLYQEVDEAIHQLVCLSNLHVQQ
KEQRQRLHRLQQVLQWLSGPGEEQLTSFAAPGDCLSALQETELRFQAFSAEVQERLAQAR
EALALEEDTASQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGSARLAGAGPGR
EAVLAALALRRAPEPSTGTFQEMRALALDLGSPAALREWGRCRARCQELERRIQQQLGEE
ASPRGHRRRRADSASSGGAQRGPHSPSPSLSSLLLPSSPGPLAAPSHCSLAPCGEDCEEE
GPELAPEAEGRPPRTVLIRGLEVTSTEVVDRTCSPREHVLLSRSGGPDGPWGVGTPRMER
KRSISAQQRLVSELIACEQEYVATLSEPVPPPGYELTPELRGTWAAALSVRERLRSFHRT
HFLRELQGCATHPLRIGACFLCHGDKFSLYAQYVKHRHKLENALAALGPPTKGSTESAPH
LPRALQQPLEQLARYGRLLEELLREAGPELSSERQALGAAVQLLREQETRGRDLLAVEAV
RGCETDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGSEGGSETFVYKQAF
KTADMGLTENIGDSGLCFELWFRRRRAREAYTLQAASPEIKLKWTSSIAQLLWRQAAHNK
ELRVQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSP
GACSLPARVEEEAWDLDVKQISLAPETLDSSGDASPGPRNSPSLQPPHPRSSTPTLATGG
ILGLSRQSHARALSDPTTPL
Download sequence
Identical sequences G1P883
ENSMLUP00000006371 ENSMLUP00000006371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]