SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006533 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006533
Domain Number 1 Region: 771-878
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000484
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 2 Region: 1077-1186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000017
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 958-1053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006533   Gene: ENSMLUG00000007138   Transcript: ENSMLUT00000007160
Sequence length 2310
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429789:6552562:6926477:-1 gene:ENSMLUG00000007138 transcript:ENSMLUT00000007160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTMSVTLSPLRSQDLDPMASDASPMAINLTPTVEQGEGEEAVKDMDSDQQYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTHSVQQDSDSKHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETAEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGGL
GDVSQVKSKPFDSWSYGEMEKEFPELIRSVGLLTVATDPIASNCSEAVSEGASQGSLSAD
DKGGCEENKAPAVEEQPGSKQGVSSPVEALTNTVQSFAKTSKQESNSPSQPGAKNQQPLP
CENTTPKRSIRDCFNYNEDSPTQPTLPKRGLFLKEDAFKNNLRGADGKRPMDLKPEMSRS
TPSLVDPPDRSKLCLVLQASYPSSPSAASQSYECLHKMGGGNLENTVKSHIKEISSSLGR
LNNCHKEKPRLKKPHKNPEEVPPCQTPKAGTGSGKQTEITRSSRVPNGIPSCTSKAVEAP
ETDSASTSSLEPYPQSSWNATLPAQSETSSSPPFTQSSGSPVGSDSVMSPVPLLSKHKSK
KSYSSSPSHVSRNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPPKPRGETIQ
NIDDWELSEMNSDSEIYPTYHVKKKRTRLGRVSPSSSSDIASSLGESIESGPLSDILSDE
ELCMPLSGMKKYMDEKSERASSSEKNESHSAKKSALIQKLMQDIQHQDNYEAIWEKIEGF
VDKLDEFIQWLNEAMETTENWTPPKAETDSLKLYLETHLSFKLNVDSHCALKEAVEEEGH
QLLELIASHKAEGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVEGA
EGTGSPKAEVQLCYLEAQRDAVEQMSLKLYSEQYTSGSKRKEEFADMSKVHAVGGTGLLD
FDSEYQELWDWLIDMESLVMDSHDLMMSEEQQQHLYKRYSVEMSIRGLKKTELLSKVEAL
KKGGVLLPNDLLEKVDSINEKWELLGKTLGEKIQDTMAGPRGSGPRDLLSPESGSLVRQL
EVRIKELKGWLRDTELFIFNSCLRQEKEGTMSAEKQLQYFQSLCGEIKQRRRGVASILRL
CQHLLDGGETCNLSADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQKKMGTESETLNVID
PGLMDLTGTSEDALEWDETDISNKLISLNEDSNDLNQEPQPVMPASKPEETGSEDPGYEE
EAGDRGGSQYASSITAPSSPHIYQVYSLHNVELYDDNHMPFLKNNPMLTSMTQPSVLTKS
LSKDSSFSSTKSLPDLLGGSNLVKPCPCHGGDMSQNSGSESGIVSEGDTDTTTNSEMCLF
NMVDGSPSNPEPEHLEPQMGDAINMLKQKFKDEDEAIKLPNSSQSSISPVGCVNGKAGDL
NSVTKHTPDCLGEELQGKHDVFTFYDYSYLQGSKLKLPMIMKQSQSEKAYVEDPLLHGFY
FDKKSCKSKHQATELQPDTPPHERILASASHEMDHNSYKSGDMEKTLTGMQNAKQLSLLS
HSSSVESLSPVGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISVSSG
SVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQKMSFTGQLSDIASSINEDS
PASLTELSSSDELSLCSEDIVLHKNKIPESNASFRKRLTHSVADESDVNVSMIVNVSCTS
ACTDDEDDSDLLSSSTLTLTEEELCLKDEDDDSSIATDDEIYEECNLMSGLDYIKNELHT
WIRPKLSLTRDKRRCHPSDEIRGGKDISSTEMTNSSDTLSIKALLNGSIKHLSENNGNSK
NLPHTHELGTQGENKKNIFKVTKDPYVADVENGNVESTPERQQDKLNEISQEPENLGSAG
KRVSESEHGKCEAAMDSSDDSHIAGRESVSQTVRHLPKKCQNHHHFENQTAASTPAEKSC
PELPPETTVTNRQDSEVLQSSCDDALSLAGKSAGCCLELEQNETEENASVGDNVSCCGCE
SGVFHPKDAEDGSVHDFVKEIIGMASTALKSKSQPETEAAAPTSLTQIKEKVLEHSHRPI
QLRKGDFYSYLSLSSHDSDCGEVTNYIEEKSNTPLPLDMTDSGLEDREDIECFFEACAED
DPDGDEPCASSPPPDEPAGHREAAVPSQAAAGSPRCSDISLSADDADMVALACPPPQKGS
DIGKEVDGLPQASNVCGESSQSATPPRLGGEKECSENPGESGMPEEHKAAWASSKAQQSK
DKAALLPNPKTLTCEDLLNLDEERHRNMHR
Download sequence
Identical sequences G1P8M4
ENSMLUP00000006533 ENSMLUP00000006533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]