SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006831 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006831
Domain Number 1 Region: 747-888
Classification Level Classification E-value
Superfamily Spectrin repeat 2.34e-38
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 203-358
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-37
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 1395-1547
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-34
Family Spectrin repeat 0.0000178
Further Details:      
 
Domain Number 4 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-33
Family Spectrin repeat 0.0000536
Further Details:      
 
Domain Number 5 Region: 1287-1429
Classification Level Classification E-value
Superfamily Spectrin repeat 7.45e-33
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 6 Region: 416-569
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-32
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 7 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 3.67e-30
Family Spectrin repeat 0.0000149
Further Details:      
 
Domain Number 8 Region: 1632-1766
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-29
Family Spectrin repeat 0.00000176
Further Details:      
 
Domain Number 9 Region: 1942-2097
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-29
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 10 Region: 1207-1324
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-29
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 11 Region: 1735-1879
Classification Level Classification E-value
Superfamily Spectrin repeat 7.68e-28
Family Spectrin repeat 0.00000259
Further Details:      
 
Domain Number 12 Region: 677-780
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-26
Family Spectrin repeat 0.0000797
Further Details:      
 
Domain Number 13 Region: 2104-2217
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 14 Region: 2347-2504
Classification Level Classification E-value
Superfamily EF-hand 5.95e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 15 Region: 1553-1662
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-20
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 16 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 17 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 18 Region: 1057-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 9.32e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 19 Region: 2219-2355
Classification Level Classification E-value
Superfamily Spectrin repeat 8.4e-16
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006831   Gene: ENSMLUG00000007420   Transcript: ENSMLUT00000007482
Sequence length 2511
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430232:312087:363512:1 gene:ENSMLUG00000007420 transcript:ENSMLUT00000007482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLLELHRQWELLLEKMREKGVKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQTHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLAILSEERTALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MDDVATRRDALLSRRNALHERAMYRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMIARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFATEDVKAKLNELNQKWESLKSKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYRSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVAADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDDTDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGDTAERLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERADLEKAWAQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQSFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDTGNS
LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS
EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV
KDKRDTINSRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD
LTGVQNLRKKHKRLEDLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRL
AQFVEHWKELKQLATARAHRGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTL
AAIQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLVKKNNHHEENISSKMKGLNGKVSDLE
KAAAQRKAKLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFD
AGLQAFQQEGIANITALKDQLLAAKHIQSKAIEARHASLMKRWSQLLANSATRKKKLLEA
QSHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSS
AQADFNQLAELDRQIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEE
NDKLRQEFAQHANAFHQWIQETRTYLLDGIAYRRVIRVYQYEVGDDLSGRSCMVEESGTL
ESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLG
MRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPM
VEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGK
PYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN
Download sequence
Identical sequences G1P9D4
ENSMLUP00000006831 ENSMLUP00000006831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]