SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006983 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000006983
Domain Number - Region: 11-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0489
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006983   Gene: ENSMLUG00000007652   Transcript: ENSMLUT00000007649
Sequence length 253
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430218:59426:72787:-1 gene:ENSMLUG00000007652 transcript:ENSMLUT00000007649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIIMKLKEQHSKIDMVHRNSSEGFFLDASRHILEAPQHGLERRHLEANQNELQAHIDQIT
EMAAVMKKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDVSENTSLS
ALVTNSDLSLRKS
Download sequence
Identical sequences G1P9R4 L5M6J5
ENSMLUP00000006983 XP_006758988.1.95426 XP_014399767.1.60319 XP_015416266.1.95426 ENSMLUP00000006983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]