SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007093 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007093
Domain Number 1 Region: 443-500
Classification Level Classification E-value
Superfamily SH3-domain 1.23e-21
Family SH3-domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007093   Gene: ENSMLUG00000007751   Transcript: ENSMLUT00000007768
Sequence length 501
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429851:3926071:3953126:-1 gene:ENSMLUG00000007751 transcript:ENSMLUT00000007768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNK
VSEEHDSLKKKELESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAARGF
GGKYGVEKDRADKSAVGFDYKGEVEKHTSQKDYSHGFGGRYGVEKDKRDKAALGYDYKGE
TEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKA
KFESMAEEKKKREEEEKAQQIAKKQQERKALVKISHEAQPPATTVEEPVVPAPLPKKISS
QVWPPPGSCSSPEPEPEPVRTSRGHPLPSLPSRQEPPEEEKKDDEEAPALPPRTLEGLQV
EKEPVYEAEPIYEAEPEPEPEPEPEPELEPEPEPENDYEDVAHMDRNEQDDELEGDYEDV
LEPEDASFPSSVADNAGSSGCPAGAGISARALYDYQGEGSDEISFDPDDIITDIEMVDEG
WWRGRCHGHFGLFPANYVNLL
Download sequence
Identical sequences G1PA07
ENSMLUP00000007093 ENSMLUP00000007093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]