SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007198 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000007198
Domain Number - Region: 16-75
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00611
Family Motor proteins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007198   Gene: ENSMLUG00000007893   Transcript: ENSMLUT00000007883
Sequence length 161
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430381:380845:382194:1 gene:ENSMLUG00000007893 transcript:ENSMLUT00000007883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNQCCKQDKEEGEEELQRRRLLEIKAKSDAAGRIQAWWRGTLVRRTLLAAALRAWIIQQ
WWRGLLWRRGCALRRGLLQIYAAEELGAVRLQSWFRMWQCHRSYGRLRGTGCLSRDPQSG
FRFQIQEAPQDPQDPRALQPPQAQRPGGAKDPEFRVEILSV
Download sequence
Identical sequences G1PA96
ENSMLUP00000007198 ENSMLUP00000007198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]