SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007456 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007456
Domain Number 1 Region: 400-619
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-51
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 610-740
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000435
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007456   Gene: ENSMLUG00000008167   Transcript: ENSMLUT00000008166
Sequence length 842
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430187:530023:536711:1 gene:ENSMLUG00000008167 transcript:ENSMLUT00000008166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQSLPTATPPTQKPPRIIRPRPPSRPRAAQSPGPPHNGSSPQEPSGTSNDAPNPMCSP
IFWEPPASSLKPPALLPPSASKTSLDSQASPDSPSSTPSPVSRRSISPEPAPRSPVPPPK
PSGSPRTPLPLPHPAPRGQAQDGPASAPGTVRRLAGKFEWGTEGRVQAAPEPAPQGGVDV
NGERETPRGSLRRRGSQENGAPDAAQACPPCCPCVCHVARPGLELRWVPVGGCEDGPKAL
CRASPLRASRSRPNPPSISHPSVVLTSYRSTAERKLLPPLKPPKPTRVRQDPTISGDPPQ
PDLRLPSEDGSQTGNSPDEAPQNDAPATMEGRDEGLKELKEQNWEVPLQDEPLYQTYRAA
VLSEELWGVSAEGSPSPTNPGDAPAFARLPGPRNTLWQELPAVRASGLLDTLSPQERRMQ
ESLFEVVTSEASYLRSLQLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQEVSEWFLEAL
LSRVRSSPHINDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQ
SLPKCERLPLPSFLLLPFQRITRLRMLLQNILHQTEEGSSRQENAQKALGAISKIIERCS
AEVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLELQGELTELGCRRGGMLFTSRPRF
TPLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRP
TQRLLQASSLSDMQRWLGAFPTPGPLPCSPDTIYEDCECSQDLCSEPSTPAKTEGQSLES
RAPPKHLHKSPEGWLKGLPGAFPAQLVCEVTGEHERRRHLRQHQRLLEAAGPSSGNPSAP
QS
Download sequence
Identical sequences G1PAW4
ENSMLUP00000007456 XP_006102665.1.53796 XP_006102666.1.53796 ENSMLUP00000007456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]