SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007590 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007590
Domain Number 1 Region: 610-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.78e-60
Family Nucleotide and nucleoside kinases 0.0000000563
Further Details:      
 
Domain Number 2 Region: 338-434
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-30
Family PDZ domain 0.0000306
Further Details:      
 
Domain Number 3 Region: 441-555,604-638
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-30
Family SH3-domain 0.0000617
Further Details:      
 
Domain Number 4 Region: 93-196
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-29
Family PDZ domain 0.000025
Further Details:      
 
Domain Number 5 Region: 197-291
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-26
Family PDZ domain 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007590   Gene: ENSMLUG00000008291   Transcript: ENSMLUT00000008317
Sequence length 802
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429781:210501:388487:-1 gene:ENSMLUG00000008291 transcript:ENSMLUT00000008317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYIFGNNTLLYSRASRGGNASSSHGSVGPKQKHGAKKDSSDELQAEPEPSRWQQIVAFF
TRRHSFIDCISVATSSTQANPPPVLVNTDSLETSTYVNGTDADFEYEEITLERGNSGLGF
SIAGGTDNPHIGDDSSIFITKIIAGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEAL
KEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEG
GAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAP
PDITNSASQPVDNHVSPSSYLGQTPASPARYSPVSKAMLGDDEITREPRKVVLHRGSTGL
GFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRTASHEQAAAALKNAG
QAVTIVAQYRPEAEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYPRALFDYDKT
KDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARL
KTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYLILITDEYGCSKGGQEEYVLS
YEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHF
VTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQ
LYPISIFIKPKSVENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYN
QVKQIIEEQSGPYIWIPAKEKL
Download sequence
Identical sequences G1PB78
ENSMLUP00000007590 ENSMLUP00000007590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]