SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007864 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007864
Domain Number 1 Region: 110-376
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-76
Family Protein kinases, catalytic subunit 0.0000115
Further Details:      
 
Domain Number 2 Region: 39-109
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-20
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007864   Gene: ENSMLUG00000008611   Transcript: ENSMLUT00000008628
Sequence length 856
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430140:134841:146828:-1 gene:ENSMLUG00000008611 transcript:ENSMLUT00000008628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLKNLFLKSPLGSWNGGGSGGGGGSGGSWPEGSPKAAAYANPVWTALFDYEPNGQDEL
ALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGPPPCEVANFQELRLEE
VIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALKA
VCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRD
LKSNNILLLQPIEGDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFSK
GSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWAQ
DPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSRE
EELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKRS
KLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPAEPG
QAWGRQSPRRQEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPLG
SPSTPPTLNGNPPRPSPEPEEPRRPAPAERSSGSGTPKLIQRALLRGTALLASLGLGRDL
QPPGGQGRERGEPQPTPPTLPPTHPPSPLPSRLIRSSPKTPQAPISRLSPDAPGPPTPAP
LLLELGVPAGQPSAKSPRREEGRRGSTVSPPPGISRSAPGTPGTPRSPPLGLISRPRPSP
LRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFRGGPQDCRAQ
TKDMGAQAPWMPEAGP
Download sequence
Identical sequences G1PBV3
XP_006101619.1.53796 ENSMLUP00000007864 ENSMLUP00000007864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]