SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007929 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000007929
Domain Number - Region: 29-107
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0151
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007929   Gene: ENSMLUG00000008709   Transcript: ENSMLUT00000008700
Sequence length 132
Comment pep:novel scaffold:Myoluc2.0:GL429924:1266174:1269066:-1 gene:ENSMLUG00000008709 transcript:ENSMLUT00000008700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDILGEAGLHFDELNKLRVLDPEVSQQTTELKEECKDFVDKIGQFQKIVGGLLELVDQ
LAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAE
QNEFIDQFIFQK
Download sequence
Identical sequences G1PC08 L5LLG0
XP_006095570.1.53796 XP_006095571.1.53796 XP_014403737.1.60319 ENSMLUP00000007929 ENSMLUP00000007929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]