SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007954 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007954
Domain Number 1 Region: 1958-2193
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-53
Family DBL homology domain (DH-domain) 0.0000408
Further Details:      
 
Domain Number 2 Region: 2193-2317
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-31
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 3 Region: 1765-1828
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000538
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007954
Domain Number - Region: 153-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000544
Family Ankyrin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007954   Gene: ENSMLUG00000008671   Transcript: ENSMLUT00000008729
Sequence length 2797
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430192:670190:790245:-1 gene:ENSMLUG00000008671 transcript:ENSMLUT00000008729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQINPTKMAVNGDCVVTVLLAEEDKVEDDVVFYLVFLGSTLHHCTSTRKVSSDTLETITP
GHDCCETVKVLLCASKEGLPVFVVAEEDFEFIQDEAYDAAQFLATSAGNQQALNFTRFLD
RSGPPSTDVNSLDEKVALAFRHLKLPAEWNVLGTNQTLRDGGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPASLALQRGYHKLHKLLTEENAGEPDSWSSLSYEIPCG
DCSVRHHRELDVYTLTSESRAHREPPLPADSCTGHIFKLMNIQQQLMKTNLKQMDNLMPL
MVTAQDPSGLLTAQDADGSFLPCASGSTDSPQPSSPPAGAESSPHGPGIPASQVERPSDF
SSAGKEENTDCSCRKKNKGVERKEEEAEPTVDSETRSNPQSCLQSMSDCGEKGTEGIPPC
EIGSEETQAKSATAATAQGSLSSGGAALPGVTLMESGPAPHFPAGEQESRSTGDAGVPET
AEGTERGLRNPDATTQKKVLEAGERTKERLENSHVGAAGASHVKDTRQPVDKAMVPNCVS
ATSSLDGETPAELVLVVSNGGAPIEKTAETETSRRCDASAGDQSPASVPAAANGKMDAPL
AHTGGAVSSADLPFPRPQNDALPKEKAETNSPHLQSQNDKPPICSPPGDDQPRAAPASGQ
STVTSSGVLAAEHRDDTVTQPGGPATGPPHAQPPPTAVCPEGPQAEPVTPVPVGDTQEDV
GFCPLEVLDKEGQTGGVNSQTPLTNALEVELPPHAVFPKAEREPVPDRAVTSGRTFSPAG
SPGSESVTKDDALSLVPSQNEKGTATPQPHTATDCRDGGDWSDPDKQPLEDRAVGLPTPP
TALDPQPSMGNASPGGFGGEQEDPCLPAAPEVRTMEGGTDSSQLHVAEAPLASDSSLTEE
GNSPVVPESSAAHGQGDRFKAVICSSTKEDTPPSGALREEQGTDPPRQESPGVQGEPGAA
ACARDKALELGGSRGTPSACLNAETKHNQEVAPPASLLTEGGAAQSPVSPGAGLAADAGQ
EAVGAEQSSSPLLPGLSPDASRAPNCNGPFAVDGVTDAQAQGETAACEASGNMALDVAVG
NALQGTAEARGTALSHSAQDPPVPEVLLRQENGIQVLPGALPDKGGTDLQAAAAPETVPA
VSEKGEPEGAHLSCPRDASEEAQMNDTRESARPPAWGDPTSGSTREEIPGSPAGCSAGRE
EPEKIIPPVPGPEPATGEQSRCEVNLRDKLSERLCDRPQAVVVQLRAVGTWLYTSEPGQS
SVSNQCLPLGLPNACQKSVLSVDGHRIPQSKNTKTQKHMKPGACCVNSKAQESMFQMHFV
TLVFSSEMPDTKADDEVDFLRNPRQSSVSEEAAGGDTAAPSGTRQGLKTQTINRESWCTI
EPCADAASLLAPPQSPECENFLGVGLGRECAPTEGELKRESGSDSDLFHSPSEDVDTIVF
SKPEEEQSVCDITGSSSSTDDTASLDRHSSHGSDVSLPQMPALHRSREQQSLDGFCSPGV
GAEGRESESEPAGSGEMEEEEMDSITEVPANCSVLRSSLRSLSPFRRHSWGPGKNAASDG
EMSHRSSMRVLGDVVRRPPIHRRSFSLEGLAGGAGVGNTPSSSLEGNSANAKELRHPFGG
EERGDSLVSLSEEDLESGQREHRMFGHQTCHRSKQQGFNYCTSAVSSTLTKSVSLMTISH
PGFDSDSPSSRSFHNTSANLTESITEENYSFLPQSPSKKDFEAKSGTKVSRTFSYIKNKM
SSSKKSKEKEKEKDKIKEKEKDSKEKEKDRKLLNGHAFSAIPVVGPISCSQCAKAFTSKD
AYTCANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSLPTVIMRNKPSQPKERPRS
AVLLADETTAAPLFPNRRSQQSMSLSKSVSIQNIAGVGNDENISNTWKFLSHSTDSLNKI
VKVNESTESLTDEGVGTDMNEGQLMGDFESESKQLEAESWSRVVDSKFLKQQKKDAVKRQ
EVIYELMQTELHHIRTLKIMSDVYSRGMMTELLFEQQMVEKLFPCLDELISIHSQFFQRI
LERKKESLVDKSERNFLIRRMGDVLVNEFSGENAERLKKTYGKFCGQHNQSVNYFKDLYT
KDKRFQAFVKKKMSSAVVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVEQQDLAQ
SLSLVKEVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDG
SVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYVFASLDQKSTVISLKKLIVREVAHEEK
GLFLISMGMKDPEMVEVHASSKEERNSWIQIIQDTINTLNRDEDEGIPSENEEEKKMLDT
KARELKEQLQQKDQQILLLLEEKEVIFRDMMECSTPLSEEYSPTLSPRILFRSNTEEALK
GGPLMKSAINEVEILQGLVSGSLGGPLGPAGSSPAGQEGTVGPVSLPRRAETFGGFDSHQ
MNASKGGDKEEGDDGQDLRRTESDSGLKKGGNANLAFMLKRNNEQVIQSIVHLHELLSTL
QGVVLQQDSYIEDQKLLLSERALARSSSRPSSLVEQEKQRSLERQRQDLADLQRQQAQHL
EERRRREREWEARERALQEREARLAQREEEVQRGQQDLERDREALLQKRGAYQYDLERLR
TAQKQLEREQEQLKRDTERLSQRQLERDVCWVSHPHTKLLRIPSFLPNPEESPLPPAPSI
AKSGSLDSELSVSPKRNSIARTHKDKGPFHILSSASQPSRAPEGPSQTPAPTSSSTRLFG
LAKPKDKKEKKKKNKGRSPSGDGPASEVPAESEEIFC
Download sequence
Identical sequences G1PC31
ENSMLUP00000007954 ENSMLUP00000007954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]