SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007981 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007981
Domain Number 1 Region: 156-294
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-27
Family SH2 domain 0.00039
Further Details:      
 
Domain Number 2 Region: 40-94
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-21
Family SH3-domain 0.00077
Further Details:      
 
Domain Number 3 Region: 121-203
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-21
Family SH3-domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007981   Gene: ENSMLUG00000008767   Transcript: ENSMLUT00000008759
Sequence length 304
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430220:346114:359787:1 gene:ENSMLUG00000008767 transcript:ENSMLUT00000008759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLGKTKRKTSARDASPTPSTDAEYPANGGADRIYDLNIPAFVKFAYVAEREDELSLVKGS
RVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFPSLRRGAPVSNGQGARV
LHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS
DGPVLPPSHVPQISYPGPAGSGRFAGREWYYGNVTRHQAECALNERGREGDFLIRDSESS
PSDFSVSLKASGKNKHFKVQLVDSVYCIGQRRFHTMDELVEHYKKAPIFTSERGEKLYLV
RALQ
Download sequence
Identical sequences G1PC51
ENSMLUP00000007981 ENSMLUP00000007981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]