SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008191 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008191
Domain Number 1 Region: 2204-2441
Classification Level Classification E-value
Superfamily Plakin repeat 3.4e-83
Family Plakin repeat 0.00000000074
Further Details:      
 
Domain Number 2 Region: 1962-2197
Classification Level Classification E-value
Superfamily Plakin repeat 5.32e-77
Family Plakin repeat 0.0000021
Further Details:      
 
Domain Number 3 Region: 2515-2555,2604-2797
Classification Level Classification E-value
Superfamily Plakin repeat 2.96e-65
Family Plakin repeat 0.0000000142
Further Details:      
 
Domain Number 4 Region: 847-975,1002-1029
Classification Level Classification E-value
Superfamily Spectrin repeat 6.37e-16
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 5 Region: 337-466
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000252
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 2454-2508
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000549
Family Plakin repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 200-283
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000158
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008191   Gene: ENSMLUG00000008939   Transcript: ENSMLUT00000008988
Sequence length 2865
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430417:6037:47662:-1 gene:ENSMLUG00000008939 transcript:ENSMLUT00000008988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCNGGSHPRINTLGRMTRAESGPDLRYEVTYGGGGGGGGGGGGGGGNSRMYYSRRYTVN
DQNSDGYCQTGTISRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLARSRELDE
CFAQANDQMEITDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGG
GGYTCQSGSGWDEFTKRLTSECLGWMRQQRAEMDMVSWGVDLASVEQHIASHRSIHNAIG
DYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDC
EEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEA
YMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNM
PLQRLLDQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSSKPIILRALCDY
KQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLAGKIEQY
YEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTISDLELHYQE
FIRNSQGSEMFGDDDKRKMQSQFTDAQKHYQTLVIQLPGHPQHQTVTTTEITHVGSCQDV
NHNKVIEANRENDKQETWMLIELQKIRRQMELCEGRMALKNILLADQGSSHHITVKINEL
KSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCA
VRALLQAILQTEDMLKVYEARLTEEETVYLDLDKVEAYRCGLKKIKTDLNLKKSLLATMK
TELQKAQQIHSQTSQQYPLYDLDLGKFSEKVTQLTDRWQRIDKQIDYRLWDLEKQIKQLR
NYRDNYQAFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHNEISGKRDKSEEVQK
IAELCANSIKDYELQLASYTSGLETLLNIPIKRTMVQSPSGVILQEAADMHSRYIELITR
SGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQTEC
SQFKAKLVSLEELKRQAELDGKAAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKAVE
DRFDQQKSDYDQLQKARQCEKESLGWQKIESEKAIKDKEFEIERLRILLQEESARKREYE
NELAKVRNHYNEEMSNLRNKFETEINITKTTIQEISMQKEDDSKNLRNQLDRLTRENRDL
KDEIVRLNDSILQTTEQRRRAEEDALQQKACGSETMQKKQQLEIELKQVIQQRSEDNARH
KQSLEEAAKTIQDKNKEIERLKADFQDEAKRRWEYENELAKVRNNYDEEIISLKNQFETE
INITKTTIHQLTMKREEDTSGYRAQIDNLTRENRSLSEEVKRLKNTLAQTTENLRRVEEN
VQQQKATGSEMSQRKQQLEIELRQVTQMRTEESLRYKQSLDDAAKTIQDKNKEIERLKQL
IETETNERQFLKDENAKLQRAQFDLQKANDSATETISKLKVHEKELTRLRIDYERISQER
TVKDQDITRFQSSLKDLQLQKQKVEEELMRLKRTASEDSCKRKQLEEELEGMRRSLKEQA
IKITSLTQQLEQVSIIKKRSEEDLRQQRDVLDGHVRDKQRTQEELRRLASEVEALRRQLL
QEQENVKQAHVRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLKL
EYDELRRGRSEADSDKNATISELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQK
QALEASNRIHESKSQCTQVVQERESLLVKIKVLEQDKIRLXRVKQRLECEKQQIQNDLNQ
WKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRDTQS
QLETERCRLQREIDKLKQRPYGSHRETQTEYEWTVDSSKLVFDGLRKKVTAMQLYECQLI
DKTTLDKLLKGKKSVEEVASEIQPFLRGAGAIAGASVSPKEKYSLVEAKRKNLITPESTV
MLLEAQAATGGIIDPHRNEKLTVDNAIARDLIDFDDRQQIYTAEKAITGFDDPFSGKTVS
LSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPR
DSQKNFVDPVTQKKVSYMQLRERCRIEPHTGLLFLSVQKRSMSFQGIRQPVTVSELVDSG
ILGLSTVNELESGRISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPG
TALELLEAQAATGFIVDPVSNLRLTVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGN
IISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDMAYKRGYFNEELSEILS
DPTDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNTLRKRRV
VIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDRKTGS
QYDIQDAIDKGLVDRKFFEQYRSGSLSLTQFADMISLKNGVGNSSGMGGSVSDEVFSSSR
HESVSKISTISSVRNLTIKSSSLSDPLEESSPIAAIFDIENLEKISIAEGIERGIVDSIT
GQRLLEAQACTGGIIHPTSGQKLSLQDAISQGLVDQEMATRLKPAQKAFIGFEGVKGKKM
SAAEAVKEKWLPYEAGQRFMEFQYLTGGLVDPEVHGRISVEEAIRKGFIDGRAAQRLQDI
SSYAKILTCPKTKLKISYKDAMNRSMVEDVTGLRLLEAASVSSKGLPSPYNMSSAPGSRS
GSRSGSRSGSRSGSRSGSRRGSFDATGNSSYTYSSYAFSSSSIGH
Download sequence
Identical sequences G1PCP0
ENSMLUP00000008191 ENSMLUP00000008191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]