SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008265 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008265
Domain Number 1 Region: 501-650
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.87e-67
Family Ankyrin repeat 0.00000157
Further Details:      
 
Domain Number 2 Region: 3-231,263-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.63e-62
Family BAR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 379-496
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.54e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000554
Further Details:      
 
Domain Number 4 Region: 255-372
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-19
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 5 Region: 999-1058
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000121
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008265   Gene: ENSMLUG00000009025   Transcript: ENSMLUT00000009072
Sequence length 1059
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429880:1263788:1336377:1 gene:ENSMLUG00000009025 transcript:ENSMLUT00000009072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFV
KFSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTK
IEKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQN
LIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQL
DQKEDSQSRQAGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCAVKNGMLTISHA
TANRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEAL
TMAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDVCCDCGSSEPTWLSTNLGILTCIECSG
IHREMGVHVSRIQSLELDKLGTSELLLAKTIGNNSFNDIMEANLPSPSPKPTPMSDMTAR
KEYITAKYVDHRFSRKTCSSPSAKLNELLEAVRSRDLLALVQVYAEGVELMEPLLEPGQE
LGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTAQGNTALHYCSMFDKPECLKLLLRS
KPTVDVVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDD
DLDDKPSPIKKERSPRPQSFCHSSSISPQDKLAQPGFGTPRDKQRLSYSAFTNQIFTSTS
TDSPTSPTSEAPPLPPRNAGKGPTGPPSTLPLGMQTSGGTSTLSKKRPPPPPPGHKRTLS
DPPSPLPHGPSNKGAVTWGNDMGPSSSSKTTNKFEGLSHQASTGSAKSALGPRVLPKLPQ
KVALRKTETSHHLSLDKASIPPEGVQKSAPLADLPQKPPGDLPPKPTELAPKPQIGDLPP
KPGELPPKPQLGDLPPKPHLSDLPPKPQMKDLPPKPQLADLLAKAPPTDIAPKSHSVDLS
PNVPARDAIQKQASEDSNDLTPEMPVPLPRKINTGKNKVRRVKTIYDCQADNEDELTFIE
GEVIIVTGEEDQEWWIGHIEGEPERKGVFPVSFVHILSD
Download sequence
Identical sequences G1PCV2
ENSMLUP00000008265 ENSMLUP00000008265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]