SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009186 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009186
Domain Number 1 Region: 216-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-56
Family DBL homology domain (DH-domain) 0.0000422
Further Details:      
 
Domain Number 2 Region: 452-573
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-32
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 3 Region: 31-91
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000792
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009186   Gene: ENSMLUG00000010039   Transcript: ENSMLUT00000010077
Sequence length 986
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429978:1801294:1826506:1 gene:ENSMLUG00000010039 transcript:ENSMLUT00000010077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRIESLTRARIDRSKELASKAREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTTRERP
SSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNV
RNRTLSVESLIDEGAEVIYNELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDV
IYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTRFLSQLLE
RRRQALCPGSTRNFIIPRLGDLLISQFSGPSAEQMRKTYSEFCSRHTKALKLYKELYARD
KRFQQFIRKVTRLAVLKRHGVQECILLVTQRITKYPVLINRILQHSHGMEEERKDLTAAL
GLVKELLCHVDQDVHELEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCL
LWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPTLDKPSVISLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRICPSREDFPLIETEDEAYLRRIKMELQQ
KDRALVELLQEKVGLFAEMTHFQVEENGSCGMPLPTLPRGLFRSESLESPRGERLLQDAI
REVEGLKDLLVGPGVELLSTREPGLPTEAESGGNMSPGITANGEARTFNGSIELCRADSD
SSQKDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARVPEGPERREKLTRA
NSRDGEAGRAGATPGAPEKQATELALLQRQHTLLQEELRRCRRLGEERAAEAGSLEARLR
ESEQARALLEREAEEARRQLAALGQADAVPQEAPWARRPLDPRRRSLPAGDALYLSFSPP
QPSRGHDRLDLPVTVRAVHRPFEEREGQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHS
PRDFTRMQDIPEETESRDGEPVAPES
Download sequence
Identical sequences G1PF60
ENSMLUP00000009186 XP_006097880.1.53796 ENSMLUP00000009186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]