SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009299 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009299
Domain Number 1 Region: 249-411,820-999
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.93e-125
Family Mammalian PLC 0.00000638
Further Details:      
 
Domain Number 2 Region: 572-685
Classification Level Classification E-value
Superfamily SH2 domain 6.87e-31
Family SH2 domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 473-589
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-27
Family SH2 domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1018-1139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.22e-25
Family PLC-like (P variant) 0.0021
Further Details:      
 
Domain Number 5 Region: 718-779
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-20
Family SH3-domain 0.0000295
Further Details:      
 
Domain Number 6 Region: 2-69
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000302
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 7 Region: 82-241
Classification Level Classification E-value
Superfamily EF-hand 0.0000000106
Family Calmodulin-like 0.047
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009299
Domain Number - Region: 399-451
Classification Level Classification E-value
Superfamily PH domain-like 0.000127
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009299   Gene: ENSMLUG00000010166   Transcript: ENSMLUT00000010202
Sequence length 1218
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429783:13296325:13309719:1 gene:ENSMLUG00000010166 transcript:ENSMLUT00000010202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNM
WIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMR
SLRERLTDLELRSSDITYGQFAQVYRSLMYSDQKTMDLPFLEACAPRAGERPELCRMSLP
EFQQFLLEYQAELWAVDRLQVQEFMLDFLRDPLREIEEPYFSLDEFVTFLFSKENSVWNS
QLDVVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGP
DGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQHFKKV
LGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPSSVMYSENDISNSIKN
GILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASGSTELHSNEKWFH
GKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHS
RQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHAS
LTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFD
SLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTF
KCAVKALFDYKAQRDDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMVSP
AVLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRPFVFSISMASVAQWSLDVA
ADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGT
ERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICG
SQLVALNFQTPDKPMQMNQALFMTGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCAICI
EVLGARHLPKNGRGIVCPFVEIEVAGAEYDNNKQKTEFVVDNGLNPVWPAKPFHFQISNP
EFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKVDIF
PAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFEARYQQPFEDFRISQEHLPDHFD
SRERRAPRRTRVNGDNRL
Download sequence
Identical sequences G1PFF2
ENSMLUP00000009299 ENSMLUP00000009299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]