SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009696 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009696
Domain Number 1 Region: 323-536
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-56
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 518-650
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 779-875
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-22
Family Pleckstrin-homology domain (PH domain) 0.00069
Further Details:      
 
Domain Number 4 Region: 630-744
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.63e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009696   Gene: ENSMLUG00000010619   Transcript: ENSMLUT00000010636
Sequence length 917
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429936:1080312:1119663:-1 gene:ENSMLUG00000010619 transcript:ENSMLUT00000010636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRDSGLALGGALEPPFAGPSDAGLGATPGPRVLPCGPSPQHHRALRFSYHLEGSQPRPG
LHQGNRILVKSLSLDPGQNIEPHPEGPQRLRSDPGPPTETPSQRPSPLKRAPGPKPQVPP
KPSYLQMPRMPPPPEPIPPPPSRPLPADPRVAKGLAPRAEASPSSAAVSSLIEKFEREPV
IVASDRPAPGPSPGPTEPAMLPQPPPQPPVPQLPEGEASRCLFLLAPGPRDGEKVPNRDS
GIDSISSPSNSEETCFVSDDGPPSHSLCPGPPALASVPVALADPHRPSSQEVDSDLEEED
EEEEEEKDREIPVPLMERQESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLL
EEARNRSSFPADVVHGIFSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFL
KMYGEYVKNFDRAVELVNTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYE
LLLKDYLLKLPHGSPDSKDAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDI
VSPTKELIKEGHILKLSAKNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGM
ELKESSNLNLPRTFLVSGKQRSLELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNST
NREDEDTPPNSPNVDLGKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKC
SEFRARLIYDNNRSNRVCTDCYVALHGVPGSSPACSQHTPQRRRSILEKQASVAAENSVI
CSFLHYMEKGGKGWHKAWFVVPENEPLVLYIYGAPQDVKAQRSLPLIGFEVGPPEAGERP
DRRHVFKITQSHLSWYFSPETEELQRRWMAVLGRAGRGDTFCPGPTLSEDREMEEAQVAA
SGATAEPSEAPQTRDKT
Download sequence
Identical sequences G1PGD6
ENSMLUP00000009696 ENSMLUP00000009696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]