SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009774 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009774
Domain Number 1 Region: 625-799
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-36
Family Phosphotyrosine-binding domain (PTB) 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009774
Domain Number - Region: 593-632
Classification Level Classification E-value
Superfamily SH3-domain 0.0063
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009774   Gene: ENSMLUG00000010723   Transcript: ENSMLUT00000010723
Sequence length 811
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430579:107504:116744:-1 gene:ENSMLUG00000010723 transcript:ENSMLUT00000010723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEEEEEEEEEEEDEEEEEKGEDKEGGRPGPEA
GTLELLIPSPSREEPHKHRPTTLHLTPLGAQDSLNNNGGFLPVPPASWQETVLCSPPQEP
LQEPPAPHPATAARPHGAQLPVGPGCDCEGNRPPGPAAPHEASPSSDPGIEVDLGSGTSG
ERGRRSSQELSSPGSDSEAGAAHLGRMISSISETELELSSSSGRSSHLTNSIEEASSPAS
EPEPEAEAEAEAEPLPPRRPAFLPVGPEDTNSEYESGSESEPDLSEDADSPWLLSNLVSR
MISEGSSPILCPGQCLSPAPRPPGEPGSPAGGAPEAAGPGGVELVDMETLCGPPPPAPPA
PRAGTAQPGPCLFLSNPTRDTIMPLWAAPGRAARQGRACSSACSEEDEDEEEEEEAEDQA
GPPGGRGAGPEVPLDASLVYDAVKYTLVVDEHTQLELVSLRRCGLGSGEDSGEASEDEAA
TLLDEGQGPDGAPGQPGPHFSKKFLNVFVNSTSRSSSTESFGLFSCLVNGEEREQTHRAV
FRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLG
SKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPASCDLEISLR
GVKLSLSGGPEFQHCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVSQESM
RPVAQSVGRAFLEYYQEHLEYACPTEDIYLE
Download sequence
Identical sequences G1PGK7
ENSMLUP00000009774 ENSMLUP00000009774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]