SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010025 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010025
Domain Number 1 Region: 753-977
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-58
Family DBL homology domain (DH-domain) 0.000000000892
Further Details:      
 
Domain Number 2 Region: 348-524
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-56
Family Regulator of G-protein signaling, RGS 0.0000000376
Further Details:      
 
Domain Number 3 Region: 995-1118
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-41
Family Pleckstrin-homology domain (PH domain) 0.00000064
Further Details:      
 
Domain Number 4 Region: 28-120
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-20
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010025
Domain Number - Region: 147-227
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010025   Gene: ENSMLUG00000010956   Transcript: ENSMLUT00000011000
Sequence length 1552
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429978:1036912:1082923:1 gene:ENSMLUG00000010956 transcript:ENSMLUT00000011000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLICFYYSFSRLSSLSLGDSAPERKSPSHHGQPDSSETTGLVQRCVIIQKDQHGFGFTVS
GDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVANSSHLEVVKLIKSGAYVALTLLGS
SPSTVGVSGLQQDPDPAGAPQVAPVIPPPPPPPPLPPPQRITGPTPLQDLEFQKHATQIL
RNMLRQEEKELQHICEMYSRNPTSLLEEQIEAARRRVTQLQLKIQQETGGLVDILPLYSD
ISQRSSEGRLSLDSQDGDSGLDSGTERFPSLSESLINRNSVLSDPGLDSPRTSPVIMARV
AQHHRWQGSDAPAAPTSDQGADQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPA
HLGVFLRYIFSQADPSPLLFYLCAEVYQQTNSKDSRSLGKDIWNIFLEKNAPLRVKVPEA
LQAEIDLRLRSGEDLRCVLCEAQEAAMPEIQEQIQDYRSKRTLGLGSLYGENDLLDLDGN
PLRERQVAEKQLAALGDILFKYEEDRSAPMDFALNTYMSHAGIRLREARSSSTAEKAPLS
APDKDKWLPFFPKTKKSSNPKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVK
PGNVRNIIQHFENNQQYDAPEPGMQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEL
KRSRKTENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIE
SPSLGFCTDVLLPHLLEDDLGQLSDLELEPDTQNWQHTVGKDVVAGLTQREIDRQEVINE
LFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLRE
EGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAE
SHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYVN
EAVKQTENRHRLEGYQETDTTSLERASNPLAADLRKSLDLTTRKMIHEGPLTWRISKDKT
LDLHVLLLEDLLVLLLKQDEKLLLKCHSKTAMGSSDSKQTFSPVLKLNAVLVRSVATDKR
AFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPTPVLPPPPGPQE
SAHQSPRSSRVGLDDSEVFQREPEPEVLPGGTGPQPGVTGKHSVLLEDLKHEGSMEATEL
GALPHPSASLDGENRGGRTRDPIVLPLPGPLFMEGLADAALEDVEILRHLILRGQLPSHP
REPQAAGEPEDDLTPTPSVVSITSHPWDPGSPGRAPTEGEGENTQLPGPEGGQPEQEDVA
LCSLEHLPPRTRNSGIWEPPELDRSPEEEASSTEAAGSYKVVRKAEVAGSKAVPALPEGG
QSEAEPPEVEGGAKATGNCFYVSMPAGPPDSSTDLSQPNGLPAWRTEPQPRGGNGEPRRP
SCSPPSLAVKDMGIIFQTIEQLTLKLNRLKDMELAYRELLRSLGGESSGGTTPVGSFHTE
AAKWADCSLSPPVKDPPPSASWDSHELGPCPEDSTRSPREDSVADAATPPGL
Download sequence
Identical sequences G1PH82
ENSMLUP00000010025 ENSMLUP00000010025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]