SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010226 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010226
Domain Number 1 Region: 1-158,196-259
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-66
Family BAR domain 0.00078
Further Details:      
 
Domain Number 2 Region: 252-282,317-374
Classification Level Classification E-value
Superfamily SH3-domain 2.57e-16
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010226   Gene: ENSMLUG00000011230   Transcript: ENSMLUT00000011224
Sequence length 375
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430232:603895:614979:-1 gene:ENSMLUG00000011230 transcript:ENSMLUT00000011224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFTEEKFGQAEKTELDANFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKL
DRKVPSRVTNGELLAQYMAEAASELGPTTPYGKTLIKVSEAEKRLGAAERDFIHAASINF
LTPLRNFLEGDWKTISKERRLLQNRRLDLDVCKARLKKAKAAEAKAATVPDFQETRPRNY
ILSASASALWNDEVDKSEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLQEFVESQ
TTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTTAATMPMEPSVAGPAPP
GEAALCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERG
NKKGKVPVTYLELLS
Download sequence
Identical sequences G1PHR8
ENSMLUP00000010226 ENSMLUP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]