SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010240 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010240
Domain Number 1 Region: 575-757
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-51
Family DBL homology domain (DH-domain) 0.000000217
Further Details:      
 
Domain Number 2 Region: 765-894
Classification Level Classification E-value
Superfamily PH domain-like 4.45e-34
Family Pleckstrin-homology domain (PH domain) 0.0000133
Further Details:      
 
Domain Number 3 Region: 261-400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000158
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 4 Region: 67-171
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000916
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010240   Gene: ENSMLUG00000011218   Transcript: ENSMLUT00000011238
Sequence length 998
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:850106:925366:1 gene:ENSMLUG00000011218 transcript:ENSMLUT00000011238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFVIDSELHLCVKDISHFLMQDIAFLSGGRGKDNAWIITFPENCNFRCIPEEVITKVLTY
LTSIARKNGSDSRFTIILDRRLDTWSSIKVSLQKISASFPGNLHLVLVLRPTSFLQRTFT
DIGFRFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENF
ALTVKDMAQMLQSFGTELAETDLPEDIPSIEGILAIRAEKYHLLKNDITAVTKEGKILLT
NLEVPDPEEAISSRFEHHEQISGDWQTVNKLLTQVHDMEIAFDEFWEKHQLKMEQYLQLW
KFEQDFQELVREVELLLNQQAELADVTGNIAHIKQKIKHLENLDENSQDLLAKVQFVILH
GHRLTSNHHYALDLICQRCTELHYLSDILVNETKHKRIQLSWTFEMHKRLQQVVSCGMEM
SAVLPSQEIDKFQSKENAQEALQDIEHFLEMALPFINFATKTLQYEFDLLLSPELKIQIQ
TVQLKLESIRTVFENQQAGFKNLKYEHVRPIQFVVPASNKAIIPKAPLFSPKPGKKTWKQ
NQSNLKIEVVHDCLEKRSSGPSSSLNNNNTLDVLKNHVLNELIQTEKIYVRELFTVLLGY
KAEMDNPEMFDLMPPLLRNKKDVLFGNMAEIYEFHSNLFMSSLENCIDAPERVGLCFLER
KTDFQMYAKYCQNKPRSEAIWKKYSECAFFQECQRKLKHRLGLDSYLLKPVQRLTKYQLL
LKELLKYSKDCEGSEQLKVALDTMLDLLKSVNDSMHQIAINGYVGNLNELGKMIVQGAFS
VWTGHKKGATKMKDFARFKPMQRHLFLYEKAIVFCKRRVESGEGSGRYPSYSFKRSLKMD
EVGITEYVKGDNRKFEIWYAGKEEIYIVQASNIDVKMIWLKEIRNILLKQQELLTVKQQQ
QRNQLTEQDQLSSQQNDERQQQAFIVPEITKSEHTSTVVGVHEATSTVQAEANTVWTEEI
SESPESWSNNYFSSSYVDSGEERTLLVLCSVSRTYLCY
Download sequence
Identical sequences G1PHT2
ENSMLUP00000010240 ENSMLUP00000010240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]