SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010306 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010306
Domain Number 1 Region: 1228-1390
Classification Level Classification E-value
Superfamily PH domain-like 1.25e-69
Family Pleckstrin-homology domain (PH domain) 0.00000389
Further Details:      
 
Domain Number 2 Region: 1014-1231
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-53
Family DBL homology domain (DH-domain) 0.0000000927
Further Details:      
 
Domain Number 3 Region: 410-525
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-20
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 4 Region: 793-907
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000117
Family PDZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010306
Domain Number - Region: 538-597
Classification Level Classification E-value
Superfamily HR1 repeat 0.0602
Family HR1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010306   Gene: ENSMLUG00000011283   Transcript: ENSMLUT00000011311
Sequence length 1621
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429892:1577872:1660192:1 gene:ENSMLUG00000011283 transcript:ENSMLUT00000011311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYTFQGSKNHSHAITGAKQKPCSLKIRASTPRRQSRSFPRMGPPQAAGPGSNPR
SPGPKPAFLTSKSNQPFPPKLGGGPRRQSLQSGAHSKARAIGPGGDFLGAHAAFAAENGF
HYAGRSRRRTAWPPRHSRPRSSKGSSLSSESSWYDSPWGPAEGSSEAEGPFAAPASPAPS
LHAGFAPGDPPQPFHPSASLSSLRELYPGAALGSPCGARLSDEDFGAPASLSHRVSFASD
MDVLSRVGRGDPGQYASFTLPCRKSKALAEEDAAKKDTLKARMRRISDWTGSLSRKKRKL
QEPRSKEGSDLFDSRSDGLHAEAPGPFQAPASLWAGGSAQRLSQRSESAHAIGSDPLRQN
IYENFMRELEISRTNTENIDTSTETAESSSESLSSLEQLDLLFKKEQGVVRKAGWLFFKP
LVTLQKEKKLELVARRKWKQYWVTLKGCTLLFYETYGKNSLDQSSAPRCALFAEDSIVQA
VPEHPKKENVFCLSNSFGDVYLFQATSQTDLENWVTAIHSACASLFAKKRGKEDTVRLLK
NQTRNLAQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIQQWEQNLERFHMDLFRMRCY
LASLQGGELPNPKSLLAAASRPSKLALGRGILSVSSFHALVCSRDDSAFRKRTLSLTQRG
RSKKGLFSSLKGLDTLARRGKEKRPSLTQMFDSDPSVNAFVGAALPAMISTFKNNGVDEL
LHMCSSAVDGAPRDHPWEVQTYIHFQDSQGVTVVIKPDHRVEDILTLACKMRQVEPSHYG
LQLRKLVDENIEYCIPAPYEYLQEQVYDEIEVFPLNVYDVQLTKTGSVSDFGFAVTAQVD
EHQHLSRIFISDVLPGGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEALFSEKSVGLTLI
ARPPGTKGTLCTSWSDSDLFSRDQKGLLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITT
GLKRSQTDGTLDQASHREKMEQTFRSAEQIAVLCRSFNATQATSMEGPREGQDPPPRPLA
RHLSDADRLRKVIQELMDTEKSYVKDLSCLFELYLEPLQNETFLTQDEMESLFGSLPEML
EFQKVFLETLEDGISASSDFNVLETPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKV
QKVLERAKTDNAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLRELVSLTDHDSE
EHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEREVTELSMGELLLHSP
VAWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHSSADLDPFKF
RWLIPISALQVRLGNAAGTENTSIWELIHTKSETEGRPETIFQLCCSDSESKTNIVKVIR
SILRENFRRHIKSEFPLEKACKDRLVPLKNRIPVSAKLASCRSLKVLRNSSSSEWPGEPG
KSSSLDSDDCSLSSSTQSSGCHPAGGGQDTPKHPHTGLTDFPDNLIKESDILSDEDEDYH
QTLRQGSPTKDIEIQFQRLRISEDPDAPPAEQQLGSAGQPRGEQPKLVRGHFCAIKRKAN
STKRERGTLLKAQARHQSLDSQPTKANLDLNSVLEREFSVQSLTSVVSEQCFYETESHGD
S
Download sequence
Identical sequences G1PHZ2
ENSMLUP00000010306 ENSMLUP00000010306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]