SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010330 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010330
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-69
Family BAR domain 0.0000000557
Further Details:      
 
Domain Number 2 Region: 286-350
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-23
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010330   Gene: ENSMLUG00000011332   Transcript: ENSMLUT00000011337
Sequence length 353
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430777:49861:54110:-1 gene:ENSMLUG00000011332 transcript:ENSMLUT00000011337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQLVSEKVGGAEGTKLDDDFKEMEKVLPVTTEKSTSQPTPQPIHWAHSFPASRAKLTMLN
TVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKCLAEVKDSLD
IEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEE
SKEVAETSMHNLLETDIEQVSQLSALVDAQLEYHRQAVQILDELASKLKRRMREASSRPK
REYKPKPRESFDLGEPEQSNGGFPAPKISASSSFRSSDKPVRTPSRSMPPLDQPSCKALY
DFEPENDGELGFHEGDIITLTNQIDENWYEGMLHGQSGFFPLSYVEVLVPLPQ
Download sequence
Identical sequences G1PI15
ENSMLUP00000010330 ENSMLUP00000010330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]