SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010409 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010409
Domain Number 1 Region: 647-842
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000414
Further Details:      
 
Domain Number 2 Region: 464-576
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-19
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 13-92
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000015
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 258-297
Classification Level Classification E-value
Superfamily WW domain 0.0000000178
Family WW domain 0.0021
Further Details:      
 
Domain Number 5 Region: 361-390
Classification Level Classification E-value
Superfamily WW domain 0.0000178
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010409   Gene: ENSMLUG00000011416   Transcript: ENSMLUT00000011427
Sequence length 844
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429796:3675607:3829788:-1 gene:ENSMLUG00000011416 transcript:ENSMLUT00000011427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKMADRSGKIVSGQVYIEVEYDYEYEAKDRKIVIRQGERYILVKKTNDDWWQVKPDENSK
AFYVPAQYVKEVTRKALMPPVKQAAGLPNNSMKVIQSLHLQRSTENVNKLPELSSFGKPS
LSIQGTGLIRDANQNFGSNYDPSQTVNLSLDLTHNNGKFSSDSHSPKVSSQNRTRLFGHF
PGPEFLDIEKTSFSQEQSCDSAEVSERAHQDSESGDELSSSSTEQIRATTPPNQGRPDSP
VYANLQELKISQSTLPPLPGSPAIQINGEWETHKDTSGRSYYYNRGTQERTWKPPRWTRD
TSISKDFQNPGDQELLSSEENCHNICYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNE
KWLKHVDDQGRQYYYSADGSRSEWELPKYNVSSQQQREIIKSRSLDRRLQEPIVLTKWRH
STIVLDTNDKESPPASKPCFPENESSPSSPKHQDTASNPKGQEKYGLLNVTKITENGKKV
RKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGAMIEMASKDKSSKKNV
FELKTRQGTELLIQSDNDTVINDWFKVLSTTINNQTVETDEAIEEETPDSPGIEKQDKEK
DHKDPRKLRSMKVSSIDSSEQKKNKKNLKKFLTRRPTLQAVREKGYIKDQVFGANLANLC
QRENDTVPKFVKLCIEYVEEYGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLNLNDSKWED
IHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVTAVKDLIKQLPKPNQDTMQI
LFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLEINS
IFGR
Download sequence
Identical sequences G1PI87
ENSMLUP00000010409 ENSMLUP00000010409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]