SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010502 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000010502
Domain Number - Region: 488-554
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00834
Family Spectrin repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010502   Gene: ENSMLUG00000011508   Transcript: ENSMLUT00000011526
Sequence length 938
Comment pep:novel scaffold:Myoluc2.0:GL429801:3447809:3593180:-1 gene:ENSMLUG00000011508 transcript:ENSMLUT00000011526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSSDSDHFRSHDRLSRWAARSIHREIGNRSTVDVTKKVKTITSTLQDTSRNLRQVDQ
MLGQYRDYSNGQAGAIEHLKESLEQSIGQLRSQRLLRNSGGRSISVTSLSTSDLDGGTVT
ESHRFPPTSPLKDYGDQQGSKRIRSRAGVRFVRETENVGQLHAFHQSLRDLSSEQVRLGD
DFNRELARRCRSDAETKRALERLTEKLSETQKQEVVSDRVERRLQEIEREMRTERELVER
RQDQLGLISLQLQEALKKQEAKTDDEGVMQNKLRQTETEKNQLEQELELSRRLLNQSEGS
RETLLYQVEELRTQLMKAEGDRKGLQHQVSQISNQLSNRQDEQGDDRRFRREGVEREKEN
LEKQMSELRVQLSFSAMASELEEAKRCMERKDQEKAHLAAQVENLTRELDTKEKQQLQML
DQLKEIQNHFETCDAKLKQSDHQISELTHHAEDATKQAEQYLLEFQQSEALRQEAEKRRE
ELKLKAQDSIRQWKLKHKKLERAMEKQSETLDQLTDKNNQIIKEKDELKSQLYVALQQIE
NLRKELNEVLTKRALQEEELHCKEQKLSDVKAHQADLELEVKDSLDTIHRLDTEIQKQNK
LQSQLKVEKAHLEEEIAELKKSQAKDKAQLLEMQEAIKNLSAIRADLANKLAEEQRARKE
VLKNLSDLKTQAESRDEETTTIITQLKLERDVHQRELADLTSSLENVRTKHEQNVQELMK
HFKKEKSEAENHIRTLKAESLEDKNIAKVHLSQLEKLKSQCDRLTEELNQNENENKKLKL
KYQSLKDNLEEKEKHISNEEEHLRRMEEARLQLKDQLLCLETEQESILGVIGKEIDAACK
TFSRDSMEKFKFFSSGPDINYDPHRWLAESKTKLQWLCEELKERENREKSLRHELMLCRQ
QLRNMTENKESELQCLLEQIERQELLLEEIHQEKRGVL
Download sequence
Identical sequences G1PIH2
ENSMLUP00000010502 ENSMLUP00000010502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]