SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010504 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010504
Domain Number 1 Region: 1038-1259
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-45
Family DBL homology domain (DH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 1249-1407
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-20
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 3 Region: 1392-1457
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010504   Gene: ENSMLUG00000011505   Transcript: ENSMLUT00000011528
Sequence length 1480
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429908:2705135:2720868:1 gene:ENSMLUG00000011505 transcript:ENSMLUT00000011528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAEPRSGAPAPIPAVAEFSVIPEALVRSSQPPAVGPKAQEGRDPSYTWTEESRLWETQ
QRDLRDVNDCATESMTSFPKEAPLDVETKQENLMAKAWDTSECQEAVPASLADRQARTPA
PPEHWACPVQGKHLDMTPLCSELRSRLEVELRPEFTSLTLGTGQAAEKEEASPDASARAR
CSSSCEEHFVETDSLQDSESGTARQGEELQESRGKERLVCPQEAKGLEVQGQEEGEVLGE
AVCSEGLLGEQEQMGEQVNGTQGGQRQKQGQMQDDMVLAXGRERIAEEGEEHDGLPTLAP
KVYSPCDLFPDACNARIPDSQTEFRAEELCPIAQTPTLEPIGCSCQSNPSPRFFPAGGPP
AQEIAQDPQPEGSQLGTGTASSGSPQVASAGAPETSPNSPASAPSTFAEVSPSRAALLAA
SPPIAIPRTKASLAAYSPETTRASFSTDIPSACGASETLLAAHPGSPSAEATVDPHSPLA
DFTGAIQHLLSNSFPGSHRTQLAPDLVGRSLSFSHSELPQRPPKPAIHGSVNPRRDRKSS
RDCSVIPEFPSSLSTLGHDSGDFTSDPHRPSSPHSSQPWGSPHNSAFAPGSPIYGSSPVF
VDTRLHEPPPPAPPKKRHVHTSEVERDGHLSAAVPTLRHCSYPPLALSSGLCGPPKVPLP
EIPDPHVARQYRPLPSTPDDSHHSRTSSSPRLRYNKPLPPTPDLFQPHHSPVSHNSPRIY
RPLPPVPVINPLTEPPPLPPKARGRNKSIQGALMNSGGQAKPRPVGQEWAVSSPHSGGRT
SWPPAMGRSTDSLASTSRRKSEVSPDIAFSNMTSLPSPSSPTTPWTMGLQEPTSEPGLSE
ESEAPAKGSLRRTDPQEGASGLRRSAIGRARQPEKPSHPHLEKASSWPHRRDTGRPPQSS
GEQAAISGEDSSKHKGWHRQGLRRPSILPEGSSDTRGPATEKPPGPSDSIVFREKKPKEV
MGGFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLDSLAEASGPASPRQPRKVLVSSE
SYLQRLSMASRNSLWQEIPVVRNSTVLLSMTHEDQKEQDAKFELIVSEASYLRSLNIAVD
HFQHSPQLRAILSNQDQQWLFSRLQDVRDVSATFLSDLEENFENNIFTFHVCDVVLNHAS
HFRRVYLPYVTNQTYQERTFQTLLSTNSSFREVLERLESDPVCQRLSLKSFLILPFQRIT
RLKLLLQVQTPPGILPSTQKEAEATKAHHALEKLIRDCNNNVQRMRRTEELIYLSQKIEF
ECKIFPLISQSRWLVKSGELAALESSVSPGLRRKLNTRPVHLHLFNDCLLLSRPREGGRF
LVFDHAPFSSIRGEKCEMKLHGPHKNLFRLFLLHNTQGTQAEFLFSTETQSEKLRWISAL
AMPREELDLLECYDSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGMRLSDGE
RGWFPVHQVEFISNPEVRARNLKEAQRVKTAKLQLVEQQT
Download sequence
Identical sequences G1PIH4
ENSMLUP00000010504 ENSMLUP00000010504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]