SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010551 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010551
Domain Number 1 Region: 311-510
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000221
Further Details:      
 
Domain Number 2 Region: 187-277
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-18
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 76-172
Classification Level Classification E-value
Superfamily PX domain 0.0000000000576
Family PX domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010551   Gene: ENSMLUG00000011552   Transcript: ENSMLUT00000011583
Sequence length 1278
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430011:1187047:1198069:-1 gene:ENSMLUG00000011552 transcript:ENSMLUT00000011583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQARSTDSLDGPGEGSVQPLPPTGGPSVKEKPGKRLSAPRGPFPRLADCAHFHYENVDFG
HIQLLLSPERDGSSFSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDTHLHRCIFDRRFS
CLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGRRLLLSEE
ASLNIPAVAAAHVVKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPS
ECVELFTERPCPGLKGDADGLLCGVPAPQGVSSLTSAVPRPRGKLAGLLRTFMRSRPSRQ
RLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQR
LRHEFDSERIPELSGPTFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEDE
RLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELES
VGLGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLVGSGPST
RLLTLEEAQARTQGRLGTPNESTAPKASDSPVERRKGERGQKQRKPGGSSWKTFFALGRG
PSIPRKKPLPWLGGMRAPPQPSGNRPDTVTLRSAKSEESLSSQASGAGLQRLSRLRRPHS
SSDAFPVGPAPAGSCESLSSSSSASSESSESSSSSAAGLGALSGSPSHRTSAWLDDGDDL
DFSPPHCLEGLRGLDFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPRATSQALLPHGP
TSPASSTALDISEPLSVSVPPAVLELLGAGGTPASLTPTPALSPSPGLCPHVIPLLPHGA
EAQLSDTCQQEVCSNLALPGPGIGPVMDSPLPPPLSLLRPGGAPPPPPNPARLMALALAE
QAQQVAQRQSQQEHGSTPSAPRSPFYCSLSLKVGGEPLGTSGSGPPAPSPDAWAPGPSPS
LPRQQSVGSLVRSQRPMGISRRGHRSSAQVSAQLGKGGGFRDVPETLSQFLCSVSSSVRT
PGCFSSAPQECLPPFLGVPKPGLYPLASSSFQPSSPTPVWRSPLGPPAPLDRGENLYYEI
EAGEGSPYPGTTQPWSPFRSMPPDRLNASYGMLDQSPPFHRSPDFLLSYPPPPSCFPHNH
LGYSALQHPARCPTRPEPLYVNLALGPRGPSSTSSSSSSPPAHPHSRSDSGPTALHLPQK
ERAPWDPHTPHRVPGAWGSPEPLLYYRAAPPAYGRQGKHHRGSLYRNGGQGREGVSPPPP
YPTPSWSLHCEGQTRSYC
Download sequence
Identical sequences G1PIL5
ENSMLUP00000010551 ENSMLUP00000010551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]