SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010880 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010880
Domain Number 1 Region: 278-462
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.46e-51
Family Nucleotide and nucleoside kinases 0.00000827
Further Details:      
 
Domain Number 2 Region: 137-269
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-34
Family SH3-domain 0.00095
Further Details:      
 
Domain Number 3 Region: 67-153
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-20
Family PDZ domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010880   Gene: ENSMLUG00000011938   Transcript: ENSMLUT00000011943
Sequence length 466
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429936:2668700:2702625:1 gene:ENSMLUG00000011938 transcript:ENSMLUT00000011943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLKASGGESGGSMRTALSDLYLEHLLQKRSRPEAVSHQLNAVTEDMYTEESAAPGSPTQ
AKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEI
NGTNVTNHSVDQLQKAMKETKGIISLKVIPNQQNRLPALQMFMRAQFDYDPKKDNLIPCK
EAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASVAQSAPSEAP
SCSPFGKKKKYKDKYLAKHSAIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKN
ALLSQNPEKFEYPAPYTTRLPKKNEEDGKEYHFISTEEMSRSISANEFLEFGSYQGNMFG
TKFDTVHRIHERNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSE
AIRSQYAHYFDLSLVNNGVDEILKKLQEAFDQACRSPQWVPVSWVY
Download sequence
Identical sequences G1PJF4
XP_006096254.1.53796 ENSMLUP00000010880 ENSMLUP00000010880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]