SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010978 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010978
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-65
Family Calponin-homology domain, CH-domain 0.00000937
Further Details:      
 
Domain Number 2 Region: 1442-1666
Classification Level Classification E-value
Superfamily Plakin repeat 3.66e-54
Family Plakin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 1670-1848
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-48
Family Plakin repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 2292-2500
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-47
Family Plakin repeat 0.00016
Further Details:      
 
Domain Number 5 Region: 6509-6666
Classification Level Classification E-value
Superfamily Spectrin repeat 3.29e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 6119-6231
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-25
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 5306-5451
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-24
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 241-357
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-23
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 9 Region: 4760-4917
Classification Level Classification E-value
Superfamily Spectrin repeat 3.55e-23
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 6662-6779
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 11 Region: 6005-6123
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-22
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 6312-6450
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-21
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 13 Region: 2585-2688
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-21
Family Plakin repeat 0.0016
Further Details:      
 
Domain Number 14 Region: 5633-5790
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-21
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 15 Region: 5195-5318
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-21
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 16 Region: 7026-7108
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.24e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 17 Region: 6728-6855,6882-6913
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-20
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 18 Region: 5871-6012
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 19 Region: 5417-5571
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-17
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 6195-6302
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-16
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 21 Region: 4974-5134
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 22 Region: 3902-4015
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-16
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 23 Region: 1158-1284,1311-1337
Classification Level Classification E-value
Superfamily Spectrin repeat 9.1e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 24 Region: 6937-7017
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000128
Family Polcalcin 0.057
Further Details:      
 
Domain Number 25 Region: 2477-2580
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000133
Family Plakin repeat 0.0062
Further Details:      
 
Domain Number 26 Region: 4473-4591
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000336
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 27 Region: 3736-3858
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000101
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 28 Region: 4651-4770
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000161
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 29 Region: 4360-4480
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000017
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 30 Region: 3980-4121
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000183
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 31 Region: 613-715
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000432
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 32 Region: 5788-5898
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000489
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 33 Region: 4197-4300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000106
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 522-612
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000017
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 35 Region: 3523-3640
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000851
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 36 Region: 2213-2292
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000246
Family Plakin repeat 0.0027
Further Details:      
 
Domain Number 37 Region: 3355-3509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000024
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 38 Region: 1355-1471
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000245
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010978
Domain Number - Region: 4128-4234
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000245
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number - Region: 5109-5187
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00777
Family Spectrin repeat 0.026
Further Details:      
 
Domain Number - Region: 720-794
Classification Level Classification E-value
Superfamily Spectrin repeat 0.013
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010978   Gene: ENSMLUG00000012010   Transcript: ENSMLUT00000012050
Sequence length 7300
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430027:211932:418966:-1 gene:ENSMLUG00000012010 transcript:ENSMLUT00000012050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFTDERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKG
RMRFHRLQNVQIALDFLKRRQKKFIYSRGPQFLSSIHLLPFGKVWGLPYFSQISDIYISG
ESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQ
SNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISA
TEVDSRWQEYQSRVDSLIPWIKQHTILMSDKSFPQNPVELKALYNQYIHFKETEILAKER
EKARIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERLELL
LQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQV
DLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPPSTLTTTHLK
AEPLTKGTHSSSTSWFRKPMTRAELVSISSSEDEGNLRFVYELLSWVEEMQMKLERAEWG
SDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYVETLGKLETQYCKLK
ETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNPNISAKKNYFSELTMEL
EEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQHVKENTAYF
QFFSDARDLESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLV
GRSKTIVQLKPRSPDHVLKSTISVKAICDYRQIEITICKNDECVLEDNSQRTKWKVISPT
GNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISWNYLRKDLDL
VKTWNLEKLRLSAPEECHQVMKALQAHYEDFLQDSRDSVLFSVADRLRLEEEVEACKTHF
QHLMKSMENEDKEETVAKMYISELRNIRLRLEECEQRLVKRIQTPASSGTDRDAWQASAL
RIAEQEHTQDDLQQLRSDLDAVSMKCNSFLHQSPSGSSVSTLHSELNLLVEKMDRVYGLS
TVYLNKLKTIDVIMRSIQDAELLVKGYEIKLSQEEAVPADLSALESHRSTLRHWLGDVKD
KNSVFSVLDEEIAKAKVVAEQLNRLTPERNLDLERYQEKGSQLQERWHRVIAQLETRQSE
LESIQEVLGDYRACHGTLIKWIEETTAQQERMKPGQAEDSRVLSEQLSQQTDLFAEIERN
QTKLDQCQKFSQQYSTAVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDAITQEFMDLR
TRYTALVTLTTQHVKYISDALQRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNTQSKA
TSSQTKELTDIEKAILEQQVLAEELTTKREQVYEAIKTSQIFLAKHGHKLSEKEKEQISE
QLNALNKTYHDLCDGSANQLHQLRSQLAQQTEQKGCRAVAGVIDLGTVEIFPIFRAMQKG
LIDQDTGLVLLESQVIMSGLIAPETSEKLSLEEGLARSLINHQMYQQLQELQDTLSLISR
LSESKGPLSVVEAIEKKIISERVGLKILEAHLATGGFSLPPNENFINLEEAFHQGLISEW
LLSELESHLRSSKNLIDPNTAEKVGLLDLMQRCIVHQESGLKLLPVKQLAGGMVSLKSGR
KVSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMACAIL
IRQLQTGGIIDTVTGHRLTIDDAVSSDLVAAKIALVILESLWSFMGLLWPESGEILPMTD
ALEQGIVSSELAHKILSERKHIKALFLPATTEIWSWNKAIENGILDKDLANNLKSICIPD
VMPHMQLADSSEQSKLNINPGASGLSSSKGQTEGMASHSDTLLFQLMTHSYINVRNGQRV
LLLDNELIETLTANSEYQANPLEVFGIGHQKPETSRELEESVNVEITETFCDRLTVQSRE
FHSSQNKEYPNQANCMEAEGKKTIIVTEGSPTENPEKDLFVGEQKVRNPNIDTLKVRGQV
KSELKWQLVGTQKEDLTEVSTKENISRGFLLIVPSEETEDVATVVEKDPVSNETPNEEWQ
TLRNASFICQKEQANPLETEHIPGKTRRPLIKSQSKKSQFQVEKTLDLDSELKSENDMNV
HSLDKGSKDDHKLSPEEQNIIGGSMMMLEKTDEADHGSETSLSCSPPSELLEEATLNRLS
TQLLDGGIFHEQTGQQLLLNEAIARGIVPSHTAVKLMGKLNMFRGFFDSQTCESLTTEEV
IDEGLMDEKLLHNVLMADKAISGVLDPRTHTLCSVKEAVAVGLLDTQTATRILEGQVVTG
GIIDLKRGKKVSVTLALNLGLVDSADQTELINLEKASKGKDTEKTVRERLISLQMETTGI
MDPDSKAPLTVMQSIDRGLLEREEAIQLLTKQVVDGGIIHHISGMRLSVDNAFKHGIIDE
DLAKQLKKVENLSLHQFFHPETKETISLSEAIKLDLVNPDLKGEIQKIQALTESFVDLIS
GRGLTLAEAEKEGLLTNKATLSSGLMHRIVDPENHRIVPYSELVKKCKIDIESGQRYLEV
IPFSDIKDGVSDKVLTLSQATQLGKVDFASTLKVLEAQANTGGIIDTATGQGLTLASVLK
QKLVDENMVRTIASHQVLNGGIIDIFNDQRVTVKEAIEKGFISPELATLIQIDTLESSDQ
GSQIEKQDGIEVCELKKEFLRKEMLIACNQTAEMSCGKEENGKLFQIGSQSAQEKVKRRI
SGEEQATKGREISLKEFECKDQDKKRASSDAKESVSIIIPSDCKGKPLGRGSVTCPHSEV
CDSKLKEVTSTNIEKNTNEEQEKVVSQIEILSHMKQSAADLDNKKIRENQREIISEAQES
NCETSGKFLSEQVIQKPTNTREKRKRGDSVKTCKPTVLSEVKLNQETAIRSDHDSSIKSQ
PVEIAIIERGKEADGEVRFSILCKAEDPSSPMIPKGVSVRNQDASTFFNSNQVNEREVKN
LSLSLTVKPEENLSQEITRGAQSEAFSSMTPRPLHYQESAGKAQVADTSQISKSDKSFQG
TTRQETNYREDSCVTSKTKETKDLILSSNEHEEKSYQEVPFDSTKALKLEEIVDSRVDPK
EVKKDFHHQDSKSDSELYGILESKMVATKEITGEKFLEMSNPIVTGAEAGSFEGIVTQGV
PRVLVSLLPEELFKDVSQKESTEQQGATMSPAIPEASEEKTVPLIYPTTKVGEETPPEKL
RESPGSEQTPFLTAPRGKGNEGVSTEPSRATKNIFNRRLCLEHDEKLVSYLSLLRDIEMR
TKQIQPVERSLAELQDLRCQAKVLDKELKDLSTLVSQELECVSQIIISQPQEVPAQLLKA
LEKDAKNLQKSLHSVSDSWSSRLLQLQNAVEVKKTRVLNQHKQLQDKLQNLRTWVGDTIL
ILNSKECSSETDADSLNQCLQQCEDLKQPMAERKSQLDALAFDVQFFLSEHAQDLSPQQS
RQMLRLLNELQGSFQGLVAHTAAQMNALQGHRQQVEQAALVKTLQKQQNTCHEKLEDLCS
WIGQAERALVGHQGRASQQDLSALQKNQSDLKDLQDDIQNRAASFASVVKDIEGFLEENQ
TKLSPQELTTLREKLHQAKEQYEALQARTRVAQKELEEVVTSALQQETEKSKAAKELAEN
RSKIDALLDWVASVGSPGGQMEQLSGASLEKGALDTTDGHMGVNQAAEKLDKQYEKMKAH
HQELLSQQQNFILATQSAQAFLDQHGHNLTPEERQTLQEKLGELKEQYATSLAQSEAGLK
QVQTLRDELQKFLQDHREFENWLERSEKELENMHQGGSSPESLPSLLKRQGSFSEDVISH
KGDLRFVTISGQKVLDTENCLEEGREPSAAGTLVKDKLKDATERYTALHSKCTRLGSHLN
MLLGHYQQFQSSADSLQAWMQACEVKVEKLLSDTVASDPGVLQQQLATTKQLQEELAEHQ
VPVEKLQKVACDLMEIKGKPAPDRKRVQETTDSILSHFQSLSSSLAERSALLQKAIAQSQ
SVQESLDSLLQSIMEVEKNLEEEQVASLSSGVIQEALATNMKLKQDIARQKSSLEATREM
VTRFMETADSTTAAVLQGKLAEVNQRFQQLCLQQQEKESSLKKLLPQAEMFEHLSEKLQQ
FMENKSRMLASGNQPDHDIAHFFQQIQELNSEMEDQQDNLDTLEHLVTELSSCGFALDLS
QHQDRIQNLKKDFTELQKIVKEREEDASSCQEQLDEFRKLVGTFQKWLKEVEGNIPPAET
FMSTKELEKQMEHLKGLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQTKTGSILPS
VGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLREHQENLQAVLSRMQEVHKEAS
SVLQWLESKEEVLKAMDASSSPTKTETVRAQAESNKAFLAELEQNSPKIQKVKEALAGLL
LTYPNSQEAENWKKMQEELNSRWERATEVTMARQRQLEESASHLACFQAAEAQLRPWLME
KELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFETRRQQHEQLNEAARGILSGPGDVSPST
SHVQKELQNINQKWIELTDKLNSRSSQIDQAIVKSTQYQKLLQDLSEKVKVVGQRLSSQS
AISTQPEAVKQQLEETSEIRSDLEQLDHEIKEAQTLCNELSVLIGEQYLKDELKKRLETV
ALPLQGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDDKQSQQAKNCPVSAKLERLQ
SQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKSHWEELSKK
TADRQSRLKDCMQKAQKYQWHVKDLVPWIEDCKAKMSDLQVTLDPVQLESSLLRSKAMLS
EVEKRRSLLEILNNAADILINSSETDEDDIRDEKAGINQNVDSLTEELQAKTGSLEEMTQ
RLKEFQESFKNIEKKVEGARHQLEIFDALGSQACSNKNLEKLRAQQEVLQALEPQVDYLR
NFTRGLVEDAPDGSDASQLLLQAEATQQGFLEVKQRVNSSCMAMENKLEGIGQFHCRVRE
MFSQLADLDDELDGMGAVGRDTDSLQSQIEDVRLFINKIQALKLDIEASEAECRQMLEEE
GTLDLLGLKRELEALNKQCGKLTERSKARQEQLELTLGRVEDFYRTLKVLSDMTTAAEEG
EALQWVVGTEVDVINQQLAAFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGKNCDVQGLE
HDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELIANQKPPSA
EYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLENLERRWT
GLLSKAAARHKQLEDILVLAKQFHETAEPVSDFLSVTEKKLANSEPVGTQTAKIQQQIIR
HKALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITITSSKALR
TLEQARQLATKFQSTYEELTGWLREVEEELAASGGQSPTGEQIPQFQQRQKELKKEVMEH
RLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTVGQRVEEIDAAIQRSQQ
YEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHR
GEIFGTCGEEQKAVLQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPW
IEETRVLIAQLPPPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEG
EMVGEKYQKAENTYAQIKEEVRQRALALDEAVSQSAQFHDKIEPMLETLENLSSRLRMPP
LIPAEVDKIRECISDNKSATMELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKL
DQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPS
IIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVKKSIDEMNNAWENLN
KTWRERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKE
FKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKL
EGALLALGQFQHALEELMSWLIHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQA
TVETVNKAGNELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFH
SEIEDFLLELTRMETQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRL
MLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWL
TLAEQNLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDV
VLIRNLLVSVQSRWEKIVQRSIERGRSLDDARKRAKQFHEAWKKLVDWLEDAESHLDAEL
EISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLSDDTQTLDNLLGEV
RDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVM
NLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSV
SKQSRLEQALKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKK
VEEKRVDVNTAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALS
ELVANAELLEELLVWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDMD
RVTKTYKRKNVEPAHGPFMEKPRSGSRKSLSQPTPPPMLIFSQSEAKNPRINQLSARWQQ
VWLLALERQRKLNDALDRLEELCLELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRID
KDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYR
PTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVM
VRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRA
ASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSSGSKLKRPTPAFHSSRTSLAGDTS
NSSSPASTGAKTTRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTS
ESSAAGGQGNSRRGLSKPSKIPTMSKKTTAASPRTPGPKR
Download sequence
Identical sequences G1PJP1
ENSMLUP00000010978 ENSMLUP00000010978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]