SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011156 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000011156
Domain Number - Region: 128-196
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0014
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011156   Gene: ENSMLUG00000012247   Transcript: ENSMLUT00000012248
Sequence length 387
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430011:977540:981174:1 gene:ENSMLUG00000012247 transcript:ENSMLUT00000012248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDPGPHSEPLNHPPGAPRELDIAESTVCPSEEERIRPEQAQTLGQGSLDPSEHLQGGL
KNTEPTSGHPRLPTPSSHEDSTGGKHRESPISGWEVLEAEQDRLHLCLLGLGLRLQDLER
GLGPWTLAQNGMVQLQTLQADLRGTAERVDALLAFSEGLAQRSEPQAWASLQQVLRALGA
HLDSIFWRLWRLQAQLVSYSLVFKEANTLDQDLEIEAESDCPGPGGIWGPWEPSSLPTPA
ELEWDPAGDIGGFGPLGQKTAWTPGAPCELCGHRGPQSRGQGLEDIFMLGLSHRKHLVGH
QRRSLLQKSQDKKSQASSNLQDVMLEVDSGAPTPVSKWPLTFFLLLFLLLVGFTLLLPQS
GSPCCSPARLARTPYLVLNYVNGPPPI
Download sequence
Identical sequences G1PK55
XP_014319730.1.53796 ENSMLUP00000011156 ENSMLUP00000011156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]