SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011413 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011413
Domain Number 1 Region: 11-176
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-36
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011413   Gene: ENSMLUG00000012536   Transcript: ENSMLUT00000012543
Sequence length 189
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431901:455:9731:-1 gene:ENSMLUG00000012536 transcript:ENSMLUT00000012543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALRSKGQTELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLCPRVQQWSHQQRVGDLFQKLNLRARSNKDGKDQVTK
NSLETLLYKPVDRVTRSTLVLHDLLKHTPPSHPDHPLLQDALRISQNFLSSINEEITPRR
QSMTVKKGE
Download sequence
Identical sequences G1PKR6
ENSMLUP00000011413 ENSMLUP00000011413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]