SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011416 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011416
Domain Number 1 Region: 190-325
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-25
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 
Domain Number 2 Region: 295-335,373-437
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.73e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 5-129
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000484
Family DBL homology domain (DH-domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011416   Gene: ENSMLUG00000012537   Transcript: ENSMLUT00000012546
Sequence length 484
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430663:167923:187687:-1 gene:ENSMLUG00000012537 transcript:ENSMLUT00000012546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRSRSQELLHIAQELLHTEETYVRRLHLLDQVAFWLGHAFVYVHSFMGSFTGKLPILTLA
RPYIWNTNDYTTTQTNLSTLQRLAPFLKMYGEVKNFDRAVELVSAWTQRSPLFRDWIHEV
SMQKSCGLTPADRALLSTRQGFPHFHSLTRPLTCRPASRGPEGEEQQTDGGLGSWARGHS
RLACVLQEKMHKLLEVYEQLGGEEAVVNPANELIKEGHIQKLSAKTGAAQDRHLFLFNSM
VLYCVPKPRLLGQKFSVREKMDISDLQVQDTSKPPAAPTFILTGRSRALELRARTEEEKK
EWIQVIEATISKHKQNSQTFKAFSAAFSQDEDPSQTPEPATTSASFEEPAVAADGRGGAA
GLEPKRGSSKIRRDKEKQSCKGCGETFNSITKRRHHCKLCGAAICGKCSEFKAESGRQSR
VCGECFLTQPVAPASTSPRAPAEPQQSVEWPRSVDPPGRLPVWPLWVSDGGLAWSKVPAA
TPAS
Download sequence
Identical sequences G1PKR9
ENSMLUP00000011416 ENSMLUP00000011416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]