SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011542 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011542
Domain Number 1 Region: 723-926
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-47
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 960-1156
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-42
Family BAR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1456-1520
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.0000222
Further Details:      
 
Domain Number 4 Region: 190-264
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 5 Region: 95-157
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 6 Region: 1224-1301
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.00000856
Further Details:      
 
Domain Number 7 Region: 19-82
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000551
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011542   Gene: ENSMLUG00000012676   Transcript: ENSMLUT00000012684
Sequence length 1523
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429833:1039:65919:1 gene:ENSMLUG00000012676 transcript:ENSMLUT00000012684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGQFPSSFVEIVTIPSLKEGERLFVCICEFTSQEPNSLPLYRGDLVILDGAPTAGWLQGR
SCWGARGFFPSSCVRELCLSSQSRQWHSQSALLQIPDYSMGQARALMGLSAQLDEELDFR
EGDVITIIGVPEPGWFEGELEGRRGIFPEGFVELLGPLRTVDESVRSGNHDDCMENGEVD
TPTGEEERGPDEEDEQPGTYGIALYRFQALEPNELDFEVGDKIRILGTLEDGWLEGSLKG
RTGIFPYRFVNLCPKTKVEETVVLPQESSLSRVPETSLDCSENSFELGEKGHESHEYEEE
KSNCIISETAASPPDHLTSEYEVNTISHWDEGTSRGPPRSPGTGHGQPLAKDSATKDSSE
VVNGVSSQPHVPFHPQLQKNQYYSRAGGSQPSSGQFSDPFPLEARTRDYSSLPSRKTSSQ
LKTLTQRASPFPEGSSLSASRVVRPSHLSPQLQGKARCSKKYHTLKEKNAAHFCSEMKPG
LQDMAPAVEALALPQGDGNVDLDSKLTQQLIEFEKSLSGTEPDKILRHFSIMDFSSEKDI
VRGSSKLITQQELPGRRKALRPPPPRPAPTSPHLLVDQNLKPEPPLAVRPSRPAPLPPSV
QQKTNAVPPKLLTCNRPTCETLEKEAPENIEKPLDQTSQCPLVLVRIQEMEQDLDMYSRA
HEELNLMLEKQQESLRAETLENLAFYESNIENLNMELQQLREMTLLSSQSSSPVAASGSV
STENPEQRMLEKRAKVVEELHQTERDYVRDLEMCIERIMVPLQQAQIPNIDFEGLFGNMQ
MVIKVSKQLLADLEISDAVGPVFLDHRDELEGTYKVYCQNHDEATSLLEIYEKDERIQKH
LQDSVAELKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTN
AVLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLT
GFAPQIRDEAFEETEKNFRMQERLIKFIRDLSLYLQHIRESACVKVVAAASMWDVCMEKG
HKDLEQFEKVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYN
CTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQFAQGLFSNCIHGYAEAHCDF
VRQALEQLKPLLSLLKVAGREGNLIAVFHEEHSRVLQQLQVFTFFPETLPATKRPFERKT
VDRQSARKPLLGLPTYMLQSEELRASLLARYPPEKLFQADRNFNAAQDLDVSLLEGDLVG
VIKKKDPMGSPNRWLIDNGVTKGFVYSSFLKPYNARRSHSDVSVGSHSSTESEHSSSSPR
FPRQNSNSTLTFNPSSMAVAFTSGPCQKQPQDASSLKELDPATLSASLNVGSSESGPSSR
PSDPHSASQPRPWDSADVAQDADQPAPTLRSYRNSQHPEMAGCSVPGRNGQDKDLVKGCA
RTAPSLEDKNEEPESSEALGNQVYFAVYTFKARNPNELSVSANQRLKILDFKDVTGNTEW
WLAEVNGKKGYVPSNYIRKAEYT
Download sequence
Identical sequences G1PL30
ENSMLUP00000011542 ENSMLUP00000011542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]