SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011645 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011645
Domain Number 1 Region: 10-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-47
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 256-447
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-35
Family BAR domain 0.0099
Further Details:      
 
Domain Number 3 Region: 589-672
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-20
Family SH3-domain 0.00067
Further Details:      
 
Domain Number 4 Region: 494-567
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000109
Family SH3-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011645   Gene: ENSMLUG00000012793   Transcript: ENSMLUT00000012798
Sequence length 674
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429969:197283:217720:-1 gene:ENSMLUG00000012793 transcript:ENSMLUT00000012798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRGADEPSSRTESPDGESRVSEDRWSLHQRLAIRELIDTEVSYLHMLRLCALDIRSRL
KQLPQGDLDVLFSNIDDIIKVNSRFLQDLQGTDAMEEKQVQLIGNLFLEFQEELERVYKV
YCANYDQALLLVESYRREPELQREIQAIIEAVVPQAGPSGLSFLLVIPLQRITKYPLLLQ
KILENTLPDASAYSVLQRATSALQDVNTNINEYKRRKEVASKYTKVEQLTLRERLARINT
HTLSKKTTRLSQLLKQEAGLVLRTEDKEFDDLEERFHWVSLCVTELKNNVAAYLDNLEAF
LRFRPQQYDLDMPGPVGQYCNLARDLQLQAFPEFKRRLEELVGQPLCSLAKALAGPQNLI
KKRLDKLLDFERLEEKLLEEGSVTYEEEEARHTYQALNSLLVAELPQFNQLAVQWLGQIL
GTFMALQRDLAKQVLQRAESSLAQLPHHHLSEPAFRKLVEDALGQTGHQLRSFQENFEKV
QTPPTVQPLLPGAERQVQALLTKYGPGKLYQVTSNTSGSRTLDLSLPRGQIVGLLQNKDT
KGNSSRWLVDTGGHRGYVPAGKLEPYQIVPREEKLRGQAGPREDSRHPTPEPSPALVASV
PAATQVVAMYPFVARNSHEVSLQAGQPVTVLEAPDKKGNPEWSLVEVDGRRGYVPSSFLA
RAPSPAPWGWSLPP
Download sequence
Identical sequences G1PLB9
ENSMLUP00000011645 ENSMLUP00000011645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]