SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011713 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011713
Domain Number 1 Region: 170-314
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 2 Region: 824-976
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 70-172
Classification Level Classification E-value
Superfamily Second domain of FERM 9.81e-28
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 4 Region: 682-804
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-26
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 5 Region: 486-594
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-21
Family DBL homology domain (DH-domain) 0.0025
Further Details:      
 
Domain Number 6 Region: 3-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-19
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011713   Gene: ENSMLUG00000012869   Transcript: ENSMLUT00000012877
Sequence length 993
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430087:243905:338233:1 gene:ENSMLUG00000012869 transcript:ENSMLUT00000012877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSQQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVV
RFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDE
ASDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARKLEMYGIRLHPAK
DREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLE
FLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKE
GGHKKVQFERKHSKIHSIRSLAMQPTEPNSEVPKQAQQRASLTPGEGAESPGGQSCQQAK
ERKVSTEECGPRQSPALQKSPAGNKRADGAVKVAAEEEEEVAKDRTQQSKPQPPQPSTGS
LTGSPHLSELSINSQGGAVPANVILSPNLSPDTKQASPLVSPLLNDQPCPRTDDEEEGRR
KRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDSMPETLKSLIFPNFEPLHK
FHTNFLKEIEQRLALWEGRSNAHIRGDYQRIGDVMLKNVQAMKHLSSHLYPHFLNCQSLR
QTVPPARKVCLRQFDGKSICYLFLATILVVLWPLFSVLSREGALEGQHPRSLSHGGISLP
CRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGVDNLVIPGREFIRLGSLSKLSGK
GLQQRMFFLFNDVLLYTSRGLTISNQFKVHGQLPLYGMTIEKSEDEWGVPHCLTLRGQRQ
SIVVAASSRSEMEKWVEDIQMAIDLAEKSSGPTPEFLASSPPDNKSPDEATVADQESEDD
LSASRTSLERQAPHRGNTMVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSNGWQKL
WVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESEDIHKDYVFKLHFKSHVYYFRAE
SEYTFERWMEVIRSATSAAPRAHTLSHKESHVY
Download sequence
Identical sequences G1PLH8
ENSMLUP00000011713 ENSMLUP00000011713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]