SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011779 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011779
Domain Number 1 Region: 65-254
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-66
Family Regulator of G-protein signaling, RGS 0.0000000157
Further Details:      
 
Domain Number 2 Region: 416-643
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-57
Family DBL homology domain (DH-domain) 0.00000065
Further Details:      
 
Domain Number 3 Region: 644-777
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-39
Family Pleckstrin-homology domain (PH domain) 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011779   Gene: ENSMLUG00000012943   Transcript: ENSMLUT00000012949
Sequence length 779
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430437:423848:436136:1 gene:ENSMLUG00000012943 transcript:ENSMLUT00000012949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGSSSSPSPAEPMEADSVVVRGAVSGESQGAPGPPRPGLVPVSIIGAEDEDFENELEANP
EEQNSQFQSLEQVKRRPAHLMALLQHVALQFEPGPLLCCLHADLLGSLGPKEAKKAFLDF
YHSFLEKTAVLRVSVPSAVAFELDRTRPDLISEDSQRQFVQEVVQSQQAAISRQLEDFRS
KRLMGMTPWEQELTQLEAWVGRDRASFEARERLVAERLLANLEEMQHTISTDEEKSAAVV
NAISLYMRHLGVRTKSGDKKTGRNFFRKKVKENRRSDEPTKTKKGLSSFLDAARWNRGEP
QAPDFRHLKTEADAEKPGLTERKGGLGVPSRDRNVGVPGQDSPGVSLQPVSGDSPDREPG
EASPELGDPPPQGPASLEPPAPLESTEEGPDTESPEPGDEGEPGRSGLELEPEEPPGWRE
LVPPGTLHSLPKGQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLEELQNI
FPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQS
FALKQLKAKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLQSIAQNTEE
PAEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNL
DITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGK
TMLRPVLRLTSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTVSERKNWCALITETAG
Download sequence
Identical sequences G1PLN8
ENSMLUP00000011779 ENSMLUP00000011779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]