SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011832 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011832
Domain Number 1 Region: 7-249
Classification Level Classification E-value
Superfamily CutC-like 1.14e-81
Family CutC-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011832   Gene: ENSMLUG00000013004   Transcript: ENSMLUT00000013006
Sequence length 253
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429833:167314:186663:-1 gene:ENSMLUG00000013004 transcript:ENSMLUT00000013006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTADGFLMEVCVDSVESAVNAERGGASRIELCSGLLEGGTTPSMGVLQVVKQCVQIPVFV
MIRPRGGDFLYSDREVEVMKADIRLAKLYGADGFVFGALTEDGHIDKELCTSLVAMCRPL
PVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIDQAKGRIVVMP
GGGITDRNLQRILEGSGATEFHCSARSARDSGMKFRNPSVAMGASLCTSEYSRKVTDVTQ
VRTLNAIANNSLV
Download sequence
Identical sequences G1PLT5
ENSMLUP00000011832 ENSMLUP00000011832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]