SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011874 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011874
Domain Number 1 Region: 1644-1744
Classification Level Classification E-value
Superfamily Plakin repeat 3.53e-19
Family Plakin repeat 0.0072
Further Details:      
 
Domain Number 2 Region: 246-371
Classification Level Classification E-value
Superfamily Spectrin repeat 1.29e-16
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 3 Region: 119-191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000602
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 4 Region: 676-789,819-846
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000662
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011874
Domain Number - Region: 569-580
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000942
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011874   Gene: ENSMLUG00000013038   Transcript: ENSMLUT00000013053
Sequence length 1749
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429839:3262704:3285995:1 gene:ENSMLUG00000013038 transcript:ENSMLUT00000013053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNKELSELIDQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDVALQKVSDSEKLL
YMLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYNLVVKEVDPQVNWAALV
EEKLDKLSSQNFGTDLPLVDYQVEQHNIFHNEVKAIGPHLAKDGGKEQNSELQAKYQKLL
AASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRN
LEAKEERINKLHSEGDQLLAAEHPGKNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDY
HQFHKDVKDAQELLRKVDSDLNQKYSPDFKDRYQIELLLRELDDQEKALDKYEHVVQGLQ
KRGQQVVPLKYRRETPLKPIPVEALCDFEGDQGLISRGYSYTLQRNNGESWDLTDSAGNA
LTAPAVCFMIPPTDPEALALADSLGSQYRSVRQKAVGTRNALQQRHEVLKAENPGDFRPA
DASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDSAQRAKDLKSLVSPLL
GQNARGAQYTCRLRLPGRAQASHLHQSCPPPPPPRPPPPPPKNKLKNIEILWCAPGKKAN
VSTLGTVILSVFAPTSSELICSCNLALAWQGPVPSHTQALNAMASELQAQKSLLSEVEQN
LQAAKQCSSSLASRFQEHCPDLERQEAEVHKLGQRFDNLRQQAELRAQSLRSAKAAYDDY
RSCCDHMLQFLSNIPSYEPQETDSLNQMETKLKNQKNLLDEIARREQEVQKVCAHSQQYQ
QAVKDYELEAEKLRSLLDLENGRSSHVSKRARLQSPAAKVREEEATLTAKFTEVNAINRQ
RLQNLEFALNLLRQKHLQPEVGVTHESQQGSQPGSRAEESWKIRKELDEETERRQQLEKE
VKSAQEEIQILQNQNPQEAVVRKEVLKKVPDPALEESFQQMQRTLTEEQHKNQLLQEELE
ALQLRLRALEQETRNGGQEYIVKEVLRIEPDRAQADEVLRLREELEELRRQKGTREAEAV
LLQQRIAALAEEKSRAREKVTEKEVVKLQNDPQLEAEYRQLQEDQQQEGKHREKQEEELS
FLQDKLKRLEKERAMAEGKVTVKEVLKVEKDMAVEREVGDLKRQYEDESAKARAHQREKS
ELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVANLRLELVEQERKYRGAEEQLKSY
QGELEALRRRGPQVEVREVTKEVIKYKTDPEMEKELQRLREEIVDKTRLIERCDLEIYQL
KQEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVESLRARLSEEQKKQVDLERERASQ
EEKIKQKEEELSQVKEKVVQQEVVRYEEEPGLRAEVDAFTQSIDVELRQIDHLRGELRRL
QRRRAELERQLEELERERQARREAELEVQRLKQRLAELEKEEGEAQEKVTHKQKVVLQQD
PQQAREHSLLKLQLEEERHRRQVLESELETLKKKLINLEKMEVKEKVVFSESVQVEKGDT
EQEIQKLKSSLEEESRNKRELDAEVGRLEAKLSELEFHNSKSSKELDFLREENHKLQLER
QNLELETRRLQTEIEMAATETRDLRNMTTVDSGTNLDSRLWSLERELDDLKRLSKDKDLE
IDELQKRLGSVAVKREQRENHLRRSIVVIDPDTGRELSPEEAHRAGLIDWNMFVKLRSQE
CDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQNGRLTAAQYDRYVNKDMSIQELAVLV
SGQKKPGSN
Download sequence
Identical sequences G1PLW9
ENSMLUP00000011874 ENSMLUP00000011874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]