SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012342 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012342
Domain Number 1 Region: 311-523
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-60
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 506-668
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-33
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 690-851
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-22
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012342   Gene: ENSMLUG00000013557   Transcript: ENSMLUT00000013562
Sequence length 879
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429797:6067606:6137606:-1 gene:ENSMLUG00000013557 transcript:ENSMLUT00000013562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYFDSVKTKLFLTRSNLLLISPCQLEEKTLAGGSTCPKITIVPPFLKSSTTALIDQNVSD
EEAQGINGKTPAKHSAASPKPQVPPKPLHLQNSPLSSIHPTPKHKALSSAAPRMEEVKPA
SASCVSKEKSSKISDLISRFEGGSTLSSYGDLKKNSAVNLNVPRTTGRHGLTTTPQQKLP
SQDPPQKQGSDVEPTQGVQTCVANGVMEAQSQVECEEDQAAAGSPDTPPQAAEPLLDTNL
VNGAGDESTTGPASPTTNDCDGNASDSSCRTPSADPALPLEEERADTDTKGQEKENGESS
SELEQLDQHQEMKETNEQKLHNIANELLLTERAYVNRLDLLDQVFYCKLLEEANRGSFPA
EMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYGEYVKGFD
NAMELVKNMTERIPQFKSVVEEIQKQKVCGNLTLQHHMLEPVQRIPRYEMLLKDYLRKLP
PDSPDWNDAKKSLEIISTAASHSNSAIRKMDNLKKLLEIYEMLGEEEDIVNPSNELIKEG
QILKLAARNTSAQERYLLLFNNMLLYCVPKFSLVGSKFTVRTRVGLDGMQIVETHNEEYP
HTFQVSGKERTLELQASSEQDKEEWIKALQETIDAFHQRYETFRNAIAKDNDIQSEVSTA
ELGKRAPRWIRDNEVTMCMKCKEAFNALTRRRHHCRACGHVVCWKCSDYKAQLEYDGGKL
SKVCKDCYQILSGFADSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIP
KQDPLVLYMYGAPQDVRAQATIPLLGYNVDDMPRSADLPHSFKLTQSKSVHSFAADSEEL
KQKWLKIIFLAVTGETPDGPNNHSATLDDNPEPKKRTGC
Download sequence
Identical sequences G1PN43
ENSMLUP00000012342 ENSMLUP00000012342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]