SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012381 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012381
Domain Number 1 Region: 13-134
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.49e-26
Family FHA domain 0.00000105
Further Details:      
 
Domain Number 2 Region: 392-450
Classification Level Classification E-value
Superfamily RING/U-box 6.86e-18
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000012381
Domain Number - Region: 283-400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0137
Family Spectrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012381   Gene: ENSMLUG00000013604   Transcript: ENSMLUT00000013606
Sequence length 488
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430331:186241:214444:-1 gene:ENSMLUG00000013604 transcript:ENSMLUT00000013606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPGSRARRERPGGRSWCLRRVGMDAEWLLLEDGSEVTLGRGFGVTYQLVSKLCPLMIS
RNHCVLKQNTEGQWTIMDNKSLNGVWLNRVRLEPLEVYSLHTGDRVQLGVPLENKESAEY
EYEVTEEDWEKMCPYLAPKNDQILGKNKGLRTKRKCSLDELEGPEAEGPSHLKFKMNKVS
SEPGQPLRSRGKGELASGPSEHWEPRVTSLEPSENVSGAHVFSGPTKVLALHHHKRKASN
LSVSQSRLELFKVTMSRILKLKTQMQEKQVAVLNEKKQTQKGDSKNIVQMEQELQDLQSQ
LCAEQAQQEARVEQLEKTFEEEQQYLQGLEKEQGEEDLKQQLAQALQEHQALMEELNRSK
KDFEAIIQAKNKELEQTKEEKEKVQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNC
AHSFCSYCINEWMKRKVECPICRKDIKSKTPSLVLDNCISKMVDNLSSEVKERRTDLIKR
RKGVKDVI
Download sequence
Identical sequences G1PN75
ENSMLUP00000012381 ENSMLUP00000012381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]