SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012437 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012437
Domain Number 1 Region: 434-656
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-56
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 219-353
Classification Level Classification E-value
Superfamily BRCT domain 1.16e-24
Family DNA topoisomerase II binding protein 1, TopBP1 0.051
Further Details:      
 
Domain Number 3 Region: 135-249
Classification Level Classification E-value
Superfamily BRCT domain 2.11e-19
Family DNA ligase 0.029
Further Details:      
 
Domain Number 4 Region: 647-792
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000668
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012437   Gene: ENSMLUG00000013658   Transcript: ENSMLUT00000013664
Sequence length 912
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429820:266495:316065:-1 gene:ENSMLUG00000013658 transcript:ENSMLUT00000013664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNSVLTCAGRTSLADSSIFDSKVTEASKENLLNGPTLYVEEEMPQVETRVVLVQEAGK
QEELIKALKTIKIMDVPVIKIKESCPGKSDEKLIKSVVNMEIKVPFVKMESVEEYESLDS
PEFENVFIVMDFQDPVFTELYKTDCRVIGPPVVLNCAQKGEPLPFSCRPLYCTSMMNLVL
CFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRIAVSLGTPIMKPE
WIYKAWERRNEQDFCASADDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGSCL
QVGDERCTHLIVEENTVKELPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTPE
LKKSVSLLSLSTPNSNRKRRRLKETLAQLSRETDLSPFPPRKRPSAEHSLSIGSLLDISN
TPESSINYGETPKSCTKSSKNSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQVP
LEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYSK
DLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRLP
SVALLLNDLKKHTAEENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDGC
PANLLSSHRSLIQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHGQT
RPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSEELPKE
NWLKMLCRHVANTICKADAENLIYTADPETFEVNTKDMDSTLSRASRAIKKTSKRVTRAF
SFSKTPRRVLRRALMTSQSSVEGRSPLSSDKHVMSRMSSTSSLAGIPSLPCTLPSFFERR
SHTLSRSTTHLI
Download sequence
Identical sequences G1PNC4
ENSMLUP00000012437 XP_006088893.1.53796 ENSMLUP00000012437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]